Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA81678_SDS_PAGE15.gif SDS-PAGE

Claudin-3 Recombinant Protein | CLDN3 recombinant protein

Recombinant Human Claudin-3

Average rating 0.0
No ratings yet
Gene Names
CLDN3; RVP1; HRVP1; C7orf1; CPE-R2; CPETR2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Claudin-3; N/A; Recombinant Human Claudin-3; Clostridium perfringens enterotoxin receptor 2; CPE-R 2; CPE-receptor 2; Rat ventral prostate, 1 protein homolog; hRVP1; CLDN3 recombinant protein
Ordering
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
30-80
Sequence
RVSAFIGSNIITSQNIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAAR
Sequence Length
220
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

product-image-AAA81678_SDS_PAGE15.gif SDS-PAGE
Related Product Information for CLDN3 recombinant protein
Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.
Product Categories/Family for CLDN3 recombinant protein
References
Analysis of a human gene homologous to rat ventral prostate.1 protein.Peacock R.E., Keen T.J., Inglehearn C.F.Genomics 46:443-449(1997) Clostridium perfringens enterotoxin utilizes two structurally related membrane proteins as functional receptors in vivo.Katahira J., Sugiyama H., Inoue N., Horiguchi Y., Matsuda M., Sugimoto N.J. Biol. Chem. 272:26652-26658(1997) An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33.1kD
NCBI Official Full Name
claudin-3
NCBI Official Synonym Full Names
claudin 3
NCBI Official Symbol
CLDN3
NCBI Official Synonym Symbols
RVP1; HRVP1; C7orf1; CPE-R2; CPETR2
NCBI Protein Information
claudin-3
UniProt Protein Name
Claudin-3
UniProt Gene Name
CLDN3
UniProt Synonym Gene Names
C7orf1; CPETR2; CPE-R 2; CPE-receptor 2; hRVP1
UniProt Entry Name
CLD3_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CLDN3 cldn3 (Catalog #AAA81678) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 30-80. The amino acid sequence is listed below: RVSAFIGSNI ITSQNIWEGL WMNCVVQSTG QMQCKVYDSL LALPQDLQAA R. It is sometimes possible for the material contained within the vial of "Claudin-3, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.