Claudin-4 (CLDN4) Recombinant Protein | CLDN4 recombinant protein
Recombinant Human Claudin-4 (CLDN4)-VLPs (Active)
Gene Names
CLDN4; CPER; CPE-R; CPETR; CPETR1; WBSCR8; hCPE-R
Purity
The purity information is not available for VLPs proteins.
Synonyms
Claudin-4 (CLDN4); N/A; Recombinant Human Claudin-4 (CLDN4)-VLPs (Active); Clostridium perfringens enterotoxin receptor; CPE-R; CPE-receptor; Williams-Beuren syndrome chromosomal region 8 protein; CLDN4 recombinant protein
Host
Mammalian cell
Purity/Purification
The purity information is not available for VLPs proteins.
Form/Format
Lyophilized powder
Lyophilized from a 0.2 um filtered PBS, 6% Trehalose, pH 7.4
Lyophilized from a 0.2 um filtered PBS, 6% Trehalose, pH 7.4
Sequence Positions
1-209aa; Full Length
Sequence
MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIVAGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAASNYV
Species
Homo sapiens (Human)
Tag
C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions)
Research Area
CancerLess than 1.0 EU/ug as determined by LAL method.
Transmembrane Domain
4TM
Biological_Activity
Measured by its binding ability in a functional ELISA. Immobilized Human CLDN4 at 5 ug/mL can bind Anti-CLDN4 recombinant antibody, the EC50 is 29.56-50.75 ng/mL.
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80 degree C.Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.
The VLPs are expressed from human 293 cells (HEK293). Mix the sample gently by repeatedly pipetting it up and down. Do not vortex.Repeated freezing and thawing is not recommended. Store the protein at -20 degree C/-80 degree C upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity.The immunization strategy should be optimized (antigen dose, regimen and adjuvant).
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80 degree C.Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.
The VLPs are expressed from human 293 cells (HEK293). Mix the sample gently by repeatedly pipetting it up and down. Do not vortex.Repeated freezing and thawing is not recommended. Store the protein at -20 degree C/-80 degree C upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity.The immunization strategy should be optimized (antigen dose, regimen and adjuvant).
Related Product Information for CLDN4 recombinant protein
Channel-forming tight junction protein that mediates paracellular chloride transport in the kidney. Plays a critical role in the paracellular reabsorption of filtered chloride in the kidney collecting ducts. Claudins play a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.
Product Categories/Family for CLDN4 recombinant protein
References
"Claudin association with CD81 defines hepatitis C virus entry."Harris H.J., Davis C., Mullins J.G., Hu K., Goodall M., Farquhar M.J., Mee C.J., McCaffrey K., Young S., Drummer H., Balfe P., McKeating J.A.J. Biol. Chem. 285:21092-21102(2010)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22,077 Da
NCBI Official Full Name
claudin-4
NCBI Official Synonym Full Names
claudin 4
NCBI Official Symbol
CLDN4
NCBI Official Synonym Symbols
CPER; CPE-R; CPETR; CPETR1; WBSCR8; hCPE-R
NCBI Protein Information
claudin-4; CPE-receptor; Clostridium perfringens enterotoxin receptor 1; Williams-Beuren syndrome chromosomal region 8 protein
UniProt Protein Name
Claudin-4
UniProt Gene Name
CLDN4
UniProt Synonym Gene Names
CPER; CPETR1; WBSCR8; CPE-R
UniProt Entry Name
CLD4_HUMAN
Similar Products
Product Notes
The CLDN4 cldn4 (Catalog #AAA279264) is a Recombinant Protein produced from Mammalian cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-209aa; Full Length. The amino acid sequence is listed below: MASMGLQVMG IALAVLGWLA VMLCCALPMW RVTAFIGSNI VTSQTIWEGL WMNCVVQSTG QMQCKVYDSL LALPQDLQAA RALVIISIIV AALGVLLSVV GGKCTNCLED ESAKAKTMIV AGVVFLLAGL MVIVPVSWTA HNIIQDFYNP LVASGQKREM GASLYVGWAA SGLLLLGGGL LCCNCPPRTD KPYSAKYSAA RSAAASNYV. It is sometimes possible for the material contained within the vial of "Claudin-4 (CLDN4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
