Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA279265_AD11.jpg Application Data (The presence of VLP-like structures was confirmed by TEM.)

Claudin-6 (CLDN6) Recombinant Protein | CLDN6 recombinant protein

Recombinant Human Claudin-6 (CLDN6)-VLPs, Fluorescent (Active)

Purity
The purity information is not available for VLPs proteins.
Synonyms
Claudin-6 (CLDN6); N/A; Recombinant Human Claudin-6 (CLDN6)-VLPs, Fluorescent (Active); UNQ757; PRO1488; CLDN6 recombinant protein
Ordering
Host
Mammalian cell
Purity/Purification
The purity information is not available for VLPs proteins.
Form/Format
Lyophilized powder
Lyophilized from a 0.2 um filtered PBS, 6% Trehalose, pH 7.4
Sequence Positions
1-220aa; Full Length
Sequence
MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV
Species
Homo sapiens (Human)
Tag
C-terminal GFP-tagged (This tag can be tested only under denaturing conditions)
Research Area
CancerLess than 1.0 EU/ug as determined by LAL method.
Transmembrane Domain
4TM
Biological_Activity
Measured by its binding ability in a functional ELISA. Immobilized Human CLDN6 at 10 ug/mL can bind Anti-CLDN6/9 recombinant antibody, the EC50 is 0.5574-0.7361 ng/mL.
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80 degree C.Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.
The VLPs are expressed from human 293 cells (HEK293). Mix the sample gently by repeatedly pipetting it up and down. Do not vortex.Repeated freezing and thawing is not recommended. Store the protein at -20 degree C/-80 degree C upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity.The immunization strategy should be optimized (antigen dose, regimen and adjuvant).

Application Data

(The presence of VLP-like structures was confirmed by TEM.)

product-image-AAA279265_AD11.jpg Application Data (The presence of VLP-like structures was confirmed by TEM.)

Bioactivity

(Measured by its binding ability in a functional ELISA. Immobilized Human CLDN6 at 10 ug/mL can bind Anti-CLDN6/9 recombinant antibody , the EC50 is 0.5574-0.7361 ng/mL.)

product-image-AAA279265_BIOACTIVITY13.jpg Bioactivity (Measured by its binding ability in a functional ELISA. Immobilized Human CLDN6 at 10 ug/mL can bind Anti-CLDN6/9 recombinant antibody , the EC50 is 0.5574-0.7361 ng/mL.)

Application Data

(is detected by Mouse anti-6*His monoclonal antibody. The two bands respectively correspond to monomer, Homodimer.)

product-image-AAA279265_AD15.jpg Application Data (is detected by Mouse anti-6*His monoclonal antibody. The two bands respectively correspond to monomer, Homodimer.)
Related Product Information for CLDN6 recombinant protein
Plays a major role in tight junction-specific obliteration of the intercellular space.(Microbial infection) Acts as a receptor for hepatitis C virus (HCV) entry into hepatic cells.
Product Categories/Family for CLDN6 recombinant protein
References
"The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment."Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Gray A.M.Genome Res. 13:2265-2270 (2003)"Complete sequencing and characterization of 21,243 full-length human cDNAs."Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Sugano S.Nat. Genet. 36:40-45 (2004)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23,292 Da
NCBI Official Full Name
claudin-6
NCBI Official Synonym Full Names
claudin 6
NCBI Official Symbol
CLDN6
NCBI Protein Information
claudin-6; skullin
UniProt Protein Name
Claudin-6
UniProt Gene Name
CLDN6
UniProt Entry Name
CLD6_HUMAN

Similar Products

Product Notes

The CLDN6 cldn6 (Catalog #AAA279265) is a Recombinant Protein produced from Mammalian cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-220aa; Full Length. The amino acid sequence is listed below: MASAGMQILG VVLTLLGWVN GLVSCALPMW KVTAFIGNSI VVAQVVWEGL WMSCVVQSTG QMQCKVYDSL LALPQDLQAA RALCVIALLV ALFGLLVYLA GAKCTTCVEE KDSKARLVLT SGIVFVISGV LTLIPVCWTA HAIIRDFYNP LVAEAQKREL GASLYLGWAA SGLLLLGGGL LCCTCPSGGS QGPSHYMARY STSAPAISRG PSEYPTKNYV. It is sometimes possible for the material contained within the vial of "Claudin-6 (CLDN6), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.