SDS-PAGE
((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)
Claudin-6(CLDN6)-Detergent Recombinant Protein | CLDN6 recombinant protein
Recombinant Human Claudin-6(CLDN6)-Detergent (Active)
Purity
Greater than 90% as determined by SDS-PAGE.
Synonyms
Claudin-6(CLDN6)-Detergent; N/A; Recombinant Human Claudin-6(CLDN6)-Detergent (Active); UNQ757; PRO1488; CLDN6 recombinant protein
Host
Mammalian cell
Purity/Purification
Greater than 90% as determined by SDS-PAGE.
Form/Format
Liquid. 50 mM HEPES, 0.15 M NaCl, 0.05% DDM, 0.01% CHS, pH7.5
Sequence
ASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV
Sequence Length
2-220aa; Partial
Species
Homo sapiens (Human)
Tag
N-terminal 10xHis-tagged and C-terminal Twin-Strep-tagged
Transmembrane Domain
4TM
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized Human CLDN6 at 2ug/mL on an Nickel Coated plate can bind Anti-CLDN6/9 recombinant antibody . The EC50 is 0.6949-1.158ng/mL.
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
SDS-PAGE
((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)
SDS-PAGE
((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)
Bioactivity
Bioactivity
Related Product Information for CLDN6 recombinant protein
Plays a major role in tight junction-specific obliteration of the intercellular space.(Microbial infection) Acts as a receptor for hepatitis C virus (HCV) entry into hepatic cells.
Product Categories/Family for CLDN6 recombinant protein
References
"The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment."Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Gray A.M.Genome Res. 13:2265-2270 (2003)"Complete sequencing and characterization of 21,243 full-length human cDNAs."Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Sugano S.Nat. Genet. 36:40-45 (2004)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
23,292 Da
NCBI Official Full Name
claudin-6
NCBI Official Synonym Full Names
claudin 6
NCBI Official Symbol
CLDN6
NCBI Protein Information
claudin-6; skullin
UniProt Protein Name
Claudin-6
UniProt Gene Name
CLDN6
UniProt Entry Name
CLD6_HUMAN
Similar Products
Product Notes
The CLDN6 cldn6 (Catalog #AAA279395) is a Recombinant Protein produced from Mammalian cell and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: ASAGMQILGV VLTLLGWVNG LVSCALPMWK VTAFIGNSIV VAQVVWEGLW MSCVVQSTGQ MQCKVYDSLL ALPQDLQAAR ALCVIALLVA LFGLLVYLAG AKCTTCVEEK DSKARLVLTS GIVFVISGVL TLIPVCWTAH AIIRDFYNPL VAEAQKRELG ASLYLGWAAS GLLLLGGGLL CCTCPSGGSQ GPSHYMARYS TSAPAISRGP SEYPTKNYV. It is sometimes possible for the material contained within the vial of "Claudin-6(CLDN6)-Detergent, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.