C-type lectin domain family 7 member A (Clec7a) Recombinant Protein | Clec7a recombinant protein
Recombinant Mouse C-type lectin domain family 7 member A (Clec7a), partial
Gene Names
Clec7a; BGR; beta-GR; Clecsf12
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
C-type lectin domain family 7 member A (Clec7a); N/A; Recombinant Mouse C-type lectin domain family 7 member A (Clec7a), partial; Clec7a recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
71-244, Partial, provide the complete extracellular domain.
Sequence
GHNSGRNPEEKDNFLSRNKENHKPTESSLDEKVAPSKASQTTGGFSQPCLPNWIMHGKSCYLFSFSGNSWYGSKRHCSQLGAHLLKIDNSKEFEFIESQTSSHRINAFWIGLSRNQSEGPWFWEDGSAFFPNSFQVRNTAPQESLLHNCVWIHGSEVYNQICNTSSYSICEKEL
Sequence Length
244
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Clec7a recombinant protein
This gene encodes a member of the C-type lectin
C-type lectin-like domain (CTL
CTLD) superfamily. The encoded glycoprotein is a small type II membrane receptor with an extracellular C-type lectin-like domain fold and a cytoplasmic domain with an immunoreceptor tyrosine-based activation motif. It functions as a pattern-recognition receptor that recognizes a variety of beta-1,3-linked and beta-1,6-linked glucans from fungi and plants, and in this way plays a role in innate immune response. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. This gene is closely linked to other CTL
CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region.
C-type lectin-like domain (CTL
CTLD) superfamily. The encoded glycoprotein is a small type II membrane receptor with an extracellular C-type lectin-like domain fold and a cytoplasmic domain with an immunoreceptor tyrosine-based activation motif. It functions as a pattern-recognition receptor that recognizes a variety of beta-1,3-linked and beta-1,6-linked glucans from fungi and plants, and in this way plays a role in innate immune response. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. This gene is closely linked to other CTL
CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
27,420 Da
NCBI Official Full Name
C-type lectin domain family 7 member A
NCBI Official Synonym Full Names
C-type lectin domain family 7, member a
NCBI Official Symbol
Clec7a
NCBI Official Synonym Symbols
BGR; beta-GR; Clecsf12
NCBI Protein Information
C-type lectin domain family 7 member A
UniProt Protein Name
C-type lectin domain family 7 member A
UniProt Gene Name
Clec7a
UniProt Synonym Gene Names
Bgr; Clecsf12; Dectin1; DC-associated C-type lectin 1; Dectin-1
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The Clec7a clec7a (Catalog #AAA116863) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 71-244, Partial, provide the complete extracellular domain. The amino acid sequence is listed below: GHNSGRNPEE KDNFLSRNKE NHKPTESSLD EKVAPSKASQ TTGGFSQPCL PNWIMHGKSC YLFSFSGNSW YGSKRHCSQL GAHLLKIDNS KEFEFIESQT SSHRINAFWI GLSRNQSEGP WFWEDGSAFF PNSFQVRNTA PQESLLHNCV WIHGSEVYNQ ICNTSSYSIC EKEL. It is sometimes possible for the material contained within the vial of "C-type lectin domain family 7 member A (Clec7a), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.