Methylosome subunit pICln (CLNS1A) Recombinant Protein | CLNS1A recombinant protein
Recombinant Rabbit Methylosome subunit pICln (CLNS1A)
Gene Names
CLNS1A; ICLN; pIcIn
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Methylosome subunit pICln (CLNS1A); N/A; Recombinant Rabbit Methylosome subunit pICln (CLNS1A); CLNS1A recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-236aa; Full Length of Mature Protein Sequence (The complete sequence will be provided upon request, including tag sequence,
Sequence
SFLKSFPPPGPTEGLRHQQPDTEAVLNGKGLGTGTLYIAESRLSWLDGSGLGFSLEYPTISLHAVSRDPNAYPQEHLYVMVNAKFGEESKELVADEEEDSDDDVEPISEFRFVPGDKSALEAMFTAMCECQALHPDPEDEDSDDYDGEEYDVEAHEQGQGDIPTFYTYEEGLSHLTAEGQATLERLEGMLSQSVSSQYNMAGVRTEDSIRDYEDGMEVDTTPTVAGQFEDADVDH
Species
Rabbit
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for CLNS1A recombinant protein
This gene encodes a protein that functions in multiple regulatory pathways. The encoded protein complexes with numerous cytosolic proteins and performs diverse functions including regulation of small nuclear ribonucleoprotein biosynthesis, platelet activation and cytoskeletal organization. The protein is also found associated with the plasma membrane where it functions as a chloride current regulator. Pseudogenes of this gene are found on chromosomes 1, 4 and 6.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
26,065 Da
NCBI Official Full Name
Methylosome subunit pICln
NCBI Official Symbol
CLNS1A
NCBI Official Synonym Symbols
ICLN; pIcIn
NCBI Protein Information
methylosome subunit pICln
UniProt Protein Name
Methylosome subunit pICln
UniProt Gene Name
CLNS1A
UniProt Synonym Gene Names
ICLN; I(Cln)
Similar Products
Product Notes
The CLNS1A clns1a (Catalog #AAA117296) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-236aa; Full Length of Mature Protein Sequence (The complete sequence will be provided upon request, including tag sequence,. The amino acid sequence is listed below: SFLKSFPPPG PTEGLRHQQP DTEAVLNGKG LGTGTLYIAE SRLSWLDGSG LGFSLEYPTI SLHAVSRDPN AYPQEHLYVM VNAKFGEESK ELVADEEEDS DDDVEPISEF RFVPGDKSAL EAMFTAMCEC QALHPDPEDE DSDDYDGEEY DVEAHEQGQG DIPTFYTYEE GLSHLTAEGQ ATLERLEGML SQSVSSQYNM AGVRTEDSIR DYEDGMEVDT TPTVAGQFED ADVDH. It is sometimes possible for the material contained within the vial of "Methylosome subunit pICln (CLNS1A), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.