Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA144208_SDS_PAGE13.jpg SDS-PAGE

Cluster Of Differentiation 40 Recombinant Protein | CD40L recombinant protein

Recombinant Cluster Of Differentiation 40 Ligand (CD40L)

Average rating 0.0
No ratings yet
Applications
Immunoprecipitation, ELISA, Western Blot, SDS-Page
Purity
>95%
Synonyms
Cluster Of Differentiation 40; N/A; Recombinant Cluster Of Differentiation 40 Ligand (CD40L); CD40L recombinant protein
Ordering
Host
Host: E Coli
Source: Prokaryotic expression
Purity/Purification
>95%
Form/Format
Supplied as lyophilized form in PBS, pH7.4, containing 5% trehalose, 0.01% sarcosyl.
Concentration
6.5 (varies by lot)
Sequence
The target protein is fused with two N-terminal Tags, His-tag and S-tag, its sequence is listed below.
MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-N REASSQAPFI ASLCLKSPGR FERILLRAAN THSSAKPCGQ QSIHLGGVFE LQPGASVFVNVTDPSQVSHG TGFTSFGLLK L
Applicable Applications for CD40L recombinant protein
IP (Immunoprecipitation), ELISA, WB (Western Blot), SDS-PAGE
Predicted Molecular Mass
14.4kDa
Accurate Molecular Mass (KD)
17kDa
Endotoxin
<1.0EU per 1ug (determined by the LAL method)
Expression System
Prokaryotic expression
Tag
two N-terminal Tags, His-tag and S-tag
Organism Species
Rhesus monkey (Simian)
Fragment
Asn180~Leu261
Usage
Reconstitute in sterile PBS, pH7.2-pH7.4.
Preparation and Storage
Storage: Avoid repeated freeze/thaw cycles. Store at 2-8 degree C for one month. Aliquot and store at -80 degree C for 12 months.
Stability Test: The thermal stability is described by the loss rate of the targetprotein. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37 degree C for 48h, and no obvious degradation andprecipitation were observed. The loss of this protein is less than 5% within the expiration date under appropriate storage condition.

SDS-PAGE

product-image-AAA144208_SDS_PAGE13.jpg SDS-PAGE

Sequence

product-image-AAA144208_SEQUENCE15.jpg Sequence

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CD40L (Catalog #AAA144208) is a Recombinant Protein produced from Host: E Coli Source: Prokaryotic expression and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Cluster Of Differentiation 40 can be used in a range of immunoassay formats including, but not limited to, IP (Immunoprecipitation), ELISA, WB (Western Blot), SDS-PAGE. Researchers should empirically determine the suitability of the CD40L for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: The target protein is fused with two N-terminal Tags, His-tag and S-tag, its sequence is listed below.
MHHHHHHSS GLVPRGSGMK ETAAAKFERQ HMDSPDLGTD DDDKAMADIG SEF-N REASSQAPFI ASLCLKSPGR FERILLRAAN THSSAKPCGQ QSIHLGGVFE LQPGASVFVN VTDPSQVSHG TGFTSFGLLK L. It is sometimes possible for the material contained within the vial of "Cluster Of Differentiation 40, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.