Chymase Recombinant Protein | Cma1 recombinant protein
Recombinant Mouse Chymase
Gene Names
Cma1; Mcp5; Mcp-5; Mcpt5; MMCP-5
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Chymase; N/A; Recombinant Mouse Chymase; Alpha-chymase; Mast cell chymase 1; Mast cell protease 5; mMCP-5; Mast cell protease I; Cma1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
22-246aa; Partial
Sequence
IIGGTECIPHSRPYMAYLEIVTSENYLSACSGFLIRRNFVLTAAHCAGRSITVLLGAHNKTSKEDTWQKLEVEKQFLHPKYDENLVVHDIMLLKLKEKAKLTLGVGTLPLSANFNFIPPGRMCRAVGWGRTNVNEPASDTLQEVKMRLQEPQACKHFTSFRHNSQLCVGNPKKMQNVYKGDSGGPLLCAGIAQGIASYVHRNAKPPAVFTRISHYRPWINKILRE
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for Cma1 recombinant protein
Major secreted protease of mast cells with suspected roles in vasoactive peptide generation, extracellular matrix degradation, and regulation of gland secretion.
References
Molecular cloning of the mouse mast cell protease-5 gene. A novel secretory granule protease expressed early in the differentiation of serosal mast cells.McNeil H.P., Austen K.F., Somerville L.L., Gurish M.F., Stevens R.L.J. Biol. Chem. 266:20316-20322(1991) Cloning and structural analysis of MMCP-1, MMCP-4 and MMCP-5, three mouse mast cell-specific serine proteases.Huang R., Blom T., Hellman L.Eur. J. Immunol. 21:1611-1621(1991) Molecular cloning and characterization of mouse mast cell chymases.Chu W., Johnson D.A., Musich P.R.Biochim. Biophys. Acta 1121:83-87(1992) Characterization of the gene encoding mouse mast cell protease 8 (mMCP-8) , and a comparative analysis of hematopoietic serine protease genes.Lunderius C., Hellman L.Immunogenetics 53:225-232(2001) Different mouse mast cell populations express various combinations of at least six distinct mast cell serine proteases.Reynolds D.S., Stevens R.L., Lane W.S., Carr M.H., Austen K.F., Serafin W.E.Proc. Natl. Acad. Sci. U.S.A. 87:3230-3234(1990) Translation and granule localization of mouse mast cell protease-5. Immunodetection with specific antipeptide Ig.McNeil H.P., Frenkel D.P., Austen F., Friend D.S., Stevens R.L.J. Immunol. 149:2466-2472(1992)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
29.2 kDa
NCBI Official Full Name
chymase preproprotein
NCBI Official Synonym Full Names
chymase 1, mast cell
NCBI Official Symbol
Cma1
NCBI Official Synonym Symbols
Mcp5; Mcp-5; Mcpt5; MMCP-5
NCBI Protein Information
chymase
UniProt Protein Name
Chymase
UniProt Gene Name
Cma1
UniProt Synonym Gene Names
Mcpt5; mMCP-5
UniProt Entry Name
CMA1_MOUSE
Similar Products
Product Notes
The Cma1 cma1 (Catalog #AAA113860) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 22-246aa; Partial. The amino acid sequence is listed below: IIGGTECIPH SRPYMAYLEI VTSENYLSAC SGFLIRRNFV LTAAHCAGRS ITVLLGAHNK TSKEDTWQKL EVEKQFLHPK YDENLVVHDI MLLKLKEKAK LTLGVGTLPL SANFNFIPPG RMCRAVGWGR TNVNEPASDT LQEVKMRLQE PQACKHFTSF RHNSQLCVGN PKKMQNVYKG DSGGPLLCAG IAQGIASYVH RNAKPPAVFT RISHYRPWIN KILRE. It is sometimes possible for the material contained within the vial of "Chymase, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
