Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA114640_SDS_PAGE15.jpg SDS-PAGE

Cytidylate kinase Recombinant Protein | cmk recombinant protein

Recombinant Escherichia coli Cytidylate kinase

Gene Names
cmk; ECK0901; JW0893; mssA; ycaF; ycaG
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cytidylate kinase; N/A; Recombinant Escherichia coli Cytidylate kinase; Cytidine monophosphate kinase; CMP kinase; Protein MssA; p25; cmk recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-227. Full Length
Sequence
MTAIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHHVDVASEDALVPLASHLDVRFVSTNGNLEVILEGEDVSGEIRTQEVANAASQVAAFPRVREALLRRQRAFRELPGLIADGRDMGTVVFPDAPVKIFLDASSEERAHRRMLQLQEKGFSVNFERLLAEIKERDDRDRNRAVAPLVPAADALVLDSTTLSIEQVIEKALQYARQKLALA
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

product-image-AAA114640_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for cmk recombinant protein
ATP, dATP, and GTP are equally effective as phosphate donors. CMP and dCMP are the best phosphate acceptors.
References
Transcriptional organization of the rpsA operon of Escherichia coli.Pedersen S., Skouv J., Kajitani M., Ishihama A.Mol. Gen. Genet. 196:135-140(1984) A 718-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 12.7-28.0 min region on the linkage map.Oshima T., Aiba H., Baba T., Fujita K., Hayashi K., Honjo A., Ikemoto K., Inada T., Itoh T., Kajihara M., Kanai K., Kashimoto K., Kimura S., Kitagawa M., Makino K., Masuda S., Miki T., Mizobuchi K., Mori H., Motomura K., Nakamura Y., Nashimoto H., Nishio Y., Saito N., Sampei G., Seki Y., Tagami H., Takemoto K., Wada C., Yamamoto Y., Yano M., Horiuchi T.DNA Res. 3:137-155(1996) The complete genome sequence of Escherichia coli K-12.Blattner F.R., Plunkett G. III, Bloch C.A., Perna N.T., Burland V., Riley M., Collado-Vides J., Glasner J.D., Rode C.K., Mayhew G.F., Gregor J., Davis N.W., Kirkpatrick H.A., Goeden M.A., Rose D.J., Mau B., Shao Y.Science 277:1453-1462(1997) Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110.Hayashi K., Morooka N., Yamamoto Y., Fujita K., Isono K., Choi S., Ohtsubo E., Baba T., Wanner B.L., Mori H., Horiuchi T.Mol. Syst. Biol. 2:E1-E5(2006) The DNA sequence of the gene rpsA of Escherichia coli coding for ribosomal protein S1.Schnier J., Isono K.Nucleic Acids Res. 10:1857-1865(1982) Multicopy suppressors, mssA and mssB, of an smbA mutation of Escherichia coli.Yamanaka K., Ogura T., Koonin E.V., Niki H., Hiraga S.Mol. Gen. Genet. 243:9-16(1994) The cmk gene encoding cytidine monophosphate kinase is located in the rpsA operon and is required for normal replication rate in Escherichia coli.Fricke J., Neuhard J., Kelln R.A., Pedersen S.J. Bacteriol. 177:517-523(1995) Structural and catalytic properties of CMP kinase from Bacillus subtilis a comparative analysis with the homologous enzyme from Escherichia coli.Schultz C.P., Ylisastigui-Pons L., Serina L., Sakamoto H., Mantsch H.H., Neuhard J., Barzu O., Gilles A.M.Arch. Biochem. Biophys. 340:144-153(1997) Structures of Escherichia coli CMP kinase alone and in complex with CDP a new fold of the nucleoside monophosphate binding domain and insights into cytosine nucleotide specificity.Briozzo P., Golinelli-Pimpaneau B., Gilles A.M., Gaucher J.F., Burlacu-Miron S., Sakamoto H., Janin J., Barzu O.Structure 6:1517-1527(1998)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40.7 kDa
NCBI Official Full Name
cytidylate kinase
NCBI Official Symbol
cmk
NCBI Official Synonym Symbols
ECK0901; JW0893; mssA; ycaF; ycaG
NCBI Protein Information
cytidylate kinase
UniProt Protein Name
Cytidylate kinase
UniProt Gene Name
cmk
UniProt Synonym Gene Names
mssA; ycaF; ycaG; CK; CMP kinase
UniProt Entry Name
KCY_ECOLI

Similar Products

Product Notes

The cmk cmk (Catalog #AAA114640) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-227. Full Length. The amino acid sequence is listed below: MTAIAPVITI DGPSGAGKGT LCKAMAEALQ WHLLDSGAIY RVLALAALHH HVDVASEDAL VPLASHLDVR FVSTNGNLEV ILEGEDVSGE IRTQEVANAA SQVAAFPRVR EALLRRQRAF RELPGLIADG RDMGTVVFPD APVKIFLDAS SEERAHRRML QLQEKGFSVN FERLLAEIKE RDDRDRNRAV APLVPAADAL VLDSTTLSIE QVIEKALQYA RQKLALA. It is sometimes possible for the material contained within the vial of "Cytidylate kinase, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.