SDS-PAGE
Calponin-2 (CNN2) Recombinant Protein | CNN2 recombinant protein
Recombinant Human Calponin-2 (CNN2)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Calponin-2 (CNN2); N/A; Recombinant Human Calponin-2 (CNN2); Calponin-2; Calponin H2, smooth muscle; Neutral calponin; CNN2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-309aa; Full-Length of the Mature Protein
Sequence
SSTQFNKGPSYGLSAEVKNRLLSKYDPQKEAELRTWIEGLTGLSIGPDFQKGLKDGTILCTLMNKLQPGSVPKINRSMQNWHQLENLSNFIKAMVSYGMNPVDLFEANDLFESGNMTQVQVSLLALAGKAKTKGLQSGVDIGVKYSEKQERNFDDATMKAGQCVIGLQMGTNKCASQSGMTAYGTRRHLYDPKNHILPPMDHSTISLQMGTNKCASQVGMTAPGTRRHIYDTKLGTDKCDNSSMSLQMGYTQGANQSGQVFGLGRQIYDPKYCPQGTVADGAPSGTGDCPDPGEVPEYPPYYQEEAGY
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
SDS-PAGE
SDS-PAGE
Related Product Information for CNN2 recombinant protein
Thin filament-associated protein that is implicated in the regulation and modulation of smooth muscle contraction. It is capable of binding to actin, calmodulin, troponin C and tropomyosin. The interaction of calponin with actin inhibits the actomyosin Mg-ATPase activity.
Product Categories/Family for CNN2 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
49.6 kDa
NCBI Official Full Name
calponin-2 isoform a
NCBI Official Synonym Full Names
calponin 2
NCBI Official Symbol
CNN2
NCBI Protein Information
calponin-2; neutral calponin; calponin H2, smooth muscle
UniProt Protein Name
Calponin-2
UniProt Gene Name
CNN2
UniProt Entry Name
CNN2_HUMAN
Similar Products
Product Notes
The CNN2 cnn2 (Catalog #AAA116917) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-309aa; Full-Length of the Mature Protein. The amino acid sequence is listed below: SSTQFNKGPS YGLSAEVKNR LLSKYDPQKE AELRTWIEGL TGLSIGPDFQ KGLKDGTILC TLMNKLQPGS VPKINRSMQN WHQLENLSNF IKAMVSYGMN PVDLFEANDL FESGNMTQVQ VSLLALAGKA KTKGLQSGVD IGVKYSEKQE RNFDDATMKA GQCVIGLQMG TNKCASQSGM TAYGTRRHLY DPKNHILPPM DHSTISLQMG TNKCASQVGM TAPGTRRHIY DTKLGTDKCD NSSMSLQMGY TQGANQSGQV FGLGRQIYDP KYCPQGTVAD GAPSGTGDCP DPGEVPEYPP YYQEEAGY. It is sometimes possible for the material contained within the vial of "Calponin-2 (CNN2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.