Bioactivity
(ActivityMeasured by its binding ability in a functional ELISA. Immobilized Human CNR1 at 10 ug/ml can bind Anti-CNR1 recombinant antibody , the EC50 is 41.72-63.54 ng/mL.)
Cannabinoid receptor 1 (CNR1) Recombinant Protein | CNR1 recombinant protein
Recombinant Human Cannabinoid receptor 1 (CNR1)-VLPs (Active)
Gene Names
CNR1; CB1; CNR; CB-R; CB1A; CB1R; CANN6; CB1K5
Purity
The purity information is not available for VLPs proteins.
Synonyms
Cannabinoid receptor 1 (CNR1); N/A; Recombinant Human Cannabinoid receptor 1 (CNR1)-VLPs (Active); CB-R; CB1; CANN6; CNR1 recombinant protein
Host
Mammalian cell
Purity/Purification
The purity information is not available for VLPs proteins.
Form/Format
Lyophilized powder
Lyophilized from a 0.2 um filtered PBS, 6% Trehalose, pH 7.4
Lyophilized from a 0.2 um filtered PBS, 6% Trehalose, pH 7.4
Sequence Positions
1-472aa; Full Length
Sequence
MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFIDFHVFHRKDSRNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDETYLMFWIGVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQPLDNSMGDSDCLHKHANNAASVHRAAESCIKSTVKIAKVTMSVSTDTSAEAL
Species
Homo sapiens (Human)
Tag
C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions)
Research Area
CardiovascularLess than 1.0 EU/ug as determined by LAL method.
Transmembrane Domain
7TM
Biological_Activity
Measured by its binding ability in a functional ELISA. Immobilized Human CNR1 at 10 ug/mL can bind Anti-CNR1 recombinant antibody, the EC50 is 41.72-63.54 ng/mL.
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80 degree C.Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.
The VLPs are expressed from human 293 cells (HEK293). Mix the sample gently by repeatedly pipetting it up and down. Do not vortex.Repeated freezing and thawing is not recommended. Store the protein at -20 degree C/-80 degree C upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity.The immunization strategy should be optimized (antigen dose, regimen and adjuvant).
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80 degree C.Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.
The VLPs are expressed from human 293 cells (HEK293). Mix the sample gently by repeatedly pipetting it up and down. Do not vortex.Repeated freezing and thawing is not recommended. Store the protein at -20 degree C/-80 degree C upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity.The immunization strategy should be optimized (antigen dose, regimen and adjuvant).
Bioactivity
(ActivityMeasured by its binding ability in a functional ELISA. Immobilized Human CNR1 at 10 ug/ml can bind Anti-CNR1 recombinant antibody , the EC50 is 41.72-63.54 ng/mL.)
Bioactivity
(ActivityMeasured by its binding ability in a functional ELISA. Immobilized Human CNR1 at 10 ug/ml can bind Anti-CNR1 recombinant antibody , the EC50 is 41.72-63.54 ng/mL.)
Application Data
(is detected by Mouse anti-6*His monoclonal antibody.)
Application Data
(is detected by Mouse anti-6*His monoclonal antibody.)
Product Categories/Family for CNR1 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
52,858 Da
NCBI Official Full Name
cannabinoid receptor 1 isoform a
NCBI Official Synonym Full Names
cannabinoid receptor 1 (brain)
NCBI Official Symbol
CNR1
NCBI Official Synonym Symbols
CB1; CNR; CB-R; CB1A; CB1R; CANN6; CB1K5
NCBI Protein Information
cannabinoid receptor 1; central cannabinoid receptor
UniProt Protein Name
Cannabinoid receptor 1
UniProt Gene Name
CNR1
UniProt Synonym Gene Names
CNR; CB-R; CB1
UniProt Entry Name
CNR1_HUMAN
Similar Products
Product Notes
The CNR1 cnr1 (Catalog #AAA279268) is a Recombinant Protein produced from Mammalian cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-472aa; Full Length. The amino acid sequence is listed below: MKSILDGLAD TTFRTITTDL LYVGSNDIQY EDIKGDMASK LGYFPQKFPL TSFRGSPFQE KMTAGDNPQL VPADQVNITE FYNKSLSSFK ENEENIQCGE NFMDIECFMV LNPSQQLAIA VLSLTLGTFT VLENLLVLCV ILHSRSLRCR PSYHFIGSLA VADLLGSVIF VYSFIDFHVF HRKDSRNVFL FKLGGVTASF TASVGSLFLT AIDRYISIHR PLAYKRIVTR PKAVVAFCLM WTIAIVIAVL PLLGWNCEKL QSVCSDIFPH IDETYLMFWI GVTSVLLLFI VYAYMYILWK AHSHAVRMIQ RGTQKSIIIH TSEDGKVQVT RPDQARMDIR LAKTLVLILV VLIICWGPLL AIMVYDVFGK MNKLIKTVFA FCSMLCLLNS TVNPIIYALR SKDLRHAFRS MFPSCEGTAQ PLDNSMGDSD CLHKHANNAA SVHRAAESCI KSTVKIAKVT MSVSTDTSAE AL. It is sometimes possible for the material contained within the vial of "Cannabinoid receptor 1 (CNR1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.