Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA116760_SDS_PAGE15.jpg SDS-PAGE

Conglutin-7 Recombinant Protein

Recombinant Arachis hypogaea (Peanut) Conglutin-7

Average rating 0.0
No ratings yet
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Conglutin-7; N/A; Recombinant Arachis hypogaea (Peanut) Conglutin-7; Conglutin-7 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
22-172. Mature full length.
Sequence
RQQWELQGDRRCQSQLERANLRPCEQHLMQKIQRDEDSYGRDPYSPSQDPYSPSQDPDRRDPYSPSPYDRRGAGSSQHQERCCNELNEFENNQRCMCEALQQIMENQSDRLQGRQQEQQFKRELRNLPQQCGLRAPQRCDLEVESGGRDRY
Sequence Length
172
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

product-image-AAA116760_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for Conglutin-7 recombinant protein
Weak inhibitor of trypsin.
References
Isolation and characterization of two complete Ara h 2 isoforms cDNA.Chatel J.-M., Bernard H., Orson F.M.Int. Arch. Allergy Immunol. 131:14-18(2003) Isolation of peanut genes encoding arachins and conglutins by expressed sequence tags.Yan Y.-S., Lin X.-D., Zhang Y.-S., Wang L., Wu K., Huang S.-Z.Plant Sci. 169:439-445(2005) Isolation of peanut genes encoding arachins and conglutins by expressed sequence tags.Yan Y.-S., Lin X.-D., Zhang Y.-S., Wang L., Wu K., Huang S.-Z.Plant Sci. 169:439-445(2005) . Isolation of peanut genes encoding arachins and conglutins by expressed sequence tags.Yan Y.-S., Lin X.-D., Zhang Y.-S., Wang L., Wu K., Huang S.-Z.Plant Sci. 169:439-445(2005) . Chromosomal and phylogenetic context for conglutin genes in Arachis based on genomic sequence.Ramos M.L., Fleming G., Chu Y., Akiyama Y., Gallo M., Ozias-Akins P.Mol. Genet. Genomics 275:578-592(2006) Chromosomal and phylogenetic context for conglutin genes in Arachis based on genomic sequence.Ramos M.L., Fleming G., Chu Y., Akiyama Y., Gallo M., Ozias-Akins P.Mol. Genet. Genomics 275:578-592(2006) . cDNA cloning of peanut seed storage protein.Yan Y.-S., Wang L., Liao B., Li H., Lin X.-D., Huang S.-Z. cDNA cloning of peanut seed storage protein.Yan Y.-S., Wang L., Liao B., Li H., Lin X.-D., Huang S.-Z.. Isolation of peanut genes encoding seed storage proteins and stress proteins from developing cotyledons by expressed sequence tags.Fu G., Yan Y.-S., Wang L., Zhong Y., Huang S.-Z. Isolation of peanut genes encoding seed storage proteins and stress proteins from developing cotyledons by expressed sequence tags.Fu G., Yan Y.-S., Wang L., Zhong Y., Huang S.-Z.. Cloning and characterization of four genes encoding peanut seed oleosins.Li C., Fu G., Zhong Y., Yan Y., Wang L., Huang S. Cloning and characterization of four genes encoding peanut seed oleosins.Li C., Fu G., Zhong Y., Yan Y., Wang L., Huang S.. Proteolytical processing of Ara h 2 into mature form.Radosavljevic J., Dobrijevic D., Blanusa M., Jadranin M., Cirkovic Velickovic T.Isolation and molecular characterization of the first genomic clone of a major peanut allergen, Ara h 2.Viquez O.M., Summer C.G., Dodo H.W.J. Allergy Clin. Immunol. 107:713-717(2001) Isolation and molecular characterization of the first genomic clone of a major peanut allergen, Ara h 2.Viquez O.M., Summer C.G., Dodo H.W.J. Allergy Clin. Immunol. 107:713-717(2001) . Isolation and molecular characterization of the first genomic clone of a major peanut allergen, Ara h 2.Viquez O.M., Summer C.G., Dodo H.W.J. Allergy Clin. Immunol. 107:713-717(2001) . Seed-specific, developmentally regulated genes of peanut.Paik-Ro O.G., Seib J.C., Smith R.L.Theor. Appl. Genet. 104:236-240(2002) Seed-specific, developmentally regulated genes of peanut.Paik-Ro O.G., Seib J.C., Smith R.L.Theor. Appl. Genet. 104:236-240(2002) . Re-investigation of the major peanut allergen Arah2 on the molecular level.Becker W.-M., Suhr M., Lindner B., Wicklein D., Lepp U.Primary sequence and site-selective hydroxylation of prolines in isoforms of a major peanut allergen protein Ara h 2.Li J., Shefcheck K., Callahan J., Fenselau C.Protein Sci. 19:174-182(2010) Suppression of seed storage proteins upon water stress in Arachis hypogea var. M-13 seeds.Katam R., Vasanthaiah H.K.N., Basha S.M., McClung S.Submitted (MAR-2007) to UniProtKB Suppression of seed storage proteins upon water stress in Arachis hypogea var. M-13 seeds.Katam R., Vasanthaiah H.K.N., Basha S.M., McClung S.Submitted (MAR-2007) to UniProtKB. Suppression of seed storage proteins upon water stress in Arachis hypogea var. M-13 seeds.Katam R., Vasanthaiah H.K.N., Basha S.M., McClung S.Submitted (MAR-2007) to UniProtKB. Structure and stability of 2S albumin-type peanut allergens implications for the severity of peanut allergic reactions.Lehmann K., Schweimer K., Reese G., Randow S., Suhr M., Becker W.-M., Vieths S., Roesch P.Biochem. J. 395:463-472(2006) The major peanut allergen, Ara h 2, functions as a trypsin inhibitor, and roasting enhances this function.Maleki S.J., Viquez O.M., Jacks T., Dodo H.W., Champagne E.T., Chung S.-Y., Landry S.J.J. Allergy Clin. Immunol. 112:190-195(2003)

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
22 kDa
NCBI Official Full Name
Conglutin-7
UniProt Protein Name
Conglutin-7
UniProt Entry Name
CONG7_ARAHY

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The Conglutin-7 (Catalog #AAA116760) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 22-172. Mature full length. The amino acid sequence is listed below: RQQWELQGDR RCQSQLERAN LRPCEQHLMQ KIQRDEDSYG RDPYSPSQDP YSPSQDPDRR DPYSPSPYDR RGAGSSQHQE RCCNELNEFE NNQRCMCEAL QQIMENQSDR LQGRQQEQQF KRELRNLPQQ CGLRAPQRCD LEVESGGRDR Y. It is sometimes possible for the material contained within the vial of "Conglutin-7, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.