Conglutin-7 Recombinant Protein

Recombinant Arachis hypogaea (Peanut) Conglutin-7

Cat. Num. AAA116760

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Conglutin-7; N/A; Recombinant Arachis hypogaea (Peanut) Conglutin-7; Conglutin-7 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 22-172. Mature full length.
• Sequence: RQQWELQGDRRCQSQLERANLRPCEQHLMQKIQRDEDSYGRDPYSPSQDPYSPSQDPDRRDPYSPSPYDRRGAGSSQHQERCCNELNEFENNQRCMCEALQQIMENQSDRLQGRQQEQQFKRELRNLPQQCGLRAPQRCDLEVESGGRDRY
• Sequence Length: 172

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for Conglutin-7 recombinant protein

Weak inhibitor of trypsin.

References

Isolation and characterization of two complete Ara h 2 isoforms cDNA.Chatel J.-M., Bernard H., Orson F.M.Int. Arch. Allergy Immunol. 131:14-18(2003) Isolation of peanut genes encoding arachins and conglutins by expressed sequence tags.Yan Y.-S., Lin X.-D., Zhang Y.-S., Wang L., Wu K., Huang S.-Z.Plant Sci. 169:439-445(2005) Isolation of peanut genes encoding arachins and conglutins by expressed sequence tags.Yan Y.-S., Lin X.-D., Zhang Y.-S., Wang L., Wu K., Huang S.-Z.Plant Sci. 169:439-445(2005) . Isolation of peanut genes encoding arachins and conglutins by expressed sequence tags.Yan Y.-S., Lin X.-D., Zhang Y.-S., Wang L., Wu K., Huang S.-Z.Plant Sci. 169:439-445(2005) . Chromosomal and phylogenetic context for conglutin genes in Arachis based on genomic sequence.Ramos M.L., Fleming G., Chu Y., Akiyama Y., Gallo M., Ozias-Akins P.Mol. Genet. Genomics 275:578-592(2006) Chromosomal and phylogenetic context for conglutin genes in Arachis based on genomic sequence.Ramos M.L., Fleming G., Chu Y., Akiyama Y., Gallo M., Ozias-Akins P.Mol. Genet. Genomics 275:578-592(2006) . cDNA cloning of peanut seed storage protein.Yan Y.-S., Wang L., Liao B., Li H., Lin X.-D., Huang S.-Z. cDNA cloning of peanut seed storage protein.Yan Y.-S., Wang L., Liao B., Li H., Lin X.-D., Huang S.-Z.. Isolation of peanut genes encoding seed storage proteins and stress proteins from developing cotyledons by expressed sequence tags.Fu G., Yan Y.-S., Wang L., Zhong Y., Huang S.-Z. Isolation of peanut genes encoding seed storage proteins and stress proteins from developing cotyledons by expressed sequence tags.Fu G., Yan Y.-S., Wang L., Zhong Y., Huang S.-Z.. Cloning and characterization of four genes encoding peanut seed oleosins.Li C., Fu G., Zhong Y., Yan Y., Wang L., Huang S. Cloning and characterization of four genes encoding peanut seed oleosins.Li C., Fu G., Zhong Y., Yan Y., Wang L., Huang S.. Proteolytical processing of Ara h 2 into mature form.Radosavljevic J., Dobrijevic D., Blanusa M., Jadranin M., Cirkovic Velickovic T.Isolation and molecular characterization of the first genomic clone of a major peanut allergen, Ara h 2.Viquez O.M., Summer C.G., Dodo H.W.J. Allergy Clin. Immunol. 107:713-717(2001) Isolation and molecular characterization of the first genomic clone of a major peanut allergen, Ara h 2.Viquez O.M., Summer C.G., Dodo H.W.J. Allergy Clin. Immunol. 107:713-717(2001) . Isolation and molecular characterization of the first genomic clone of a major peanut allergen, Ara h 2.Viquez O.M., Summer C.G., Dodo H.W.J. Allergy Clin. Immunol. 107:713-717(2001) . Seed-specific, developmentally regulated genes of peanut.Paik-Ro O.G., Seib J.C., Smith R.L.Theor. Appl. Genet. 104:236-240(2002) Seed-specific, developmentally regulated genes of peanut.Paik-Ro O.G., Seib J.C., Smith R.L.Theor. Appl. Genet. 104:236-240(2002) . Re-investigation of the major peanut allergen Arah2 on the molecular level.Becker W.-M., Suhr M., Lindner B., Wicklein D., Lepp U.Primary sequence and site-selective hydroxylation of prolines in isoforms of a major peanut allergen protein Ara h 2.Li J., Shefcheck K., Callahan J., Fenselau C.Protein Sci. 19:174-182(2010) Suppression of seed storage proteins upon water stress in Arachis hypogea var. M-13 seeds.Katam R., Vasanthaiah H.K.N., Basha S.M., McClung S.Submitted (MAR-2007) to UniProtKB Suppression of seed storage proteins upon water stress in Arachis hypogea var. M-13 seeds.Katam R., Vasanthaiah H.K.N., Basha S.M., McClung S.Submitted (MAR-2007) to UniProtKB. Suppression of seed storage proteins upon water stress in Arachis hypogea var. M-13 seeds.Katam R., Vasanthaiah H.K.N., Basha S.M., McClung S.Submitted (MAR-2007) to UniProtKB. Structure and stability of 2S albumin-type peanut allergens implications for the severity of peanut allergic reactions.Lehmann K., Schweimer K., Reese G., Randow S., Suhr M., Becker W.-M., Vieths S., Roesch P.Biochem. J. 395:463-472(2006) The major peanut allergen, Ara h 2, functions as a trypsin inhibitor, and roasting enhances this function.Maleki S.J., Viquez O.M., Jacks T., Dodo H.W., Champagne E.T., Chung S.-Y., Landry S.J.J. Allergy Clin. Immunol. 112:190-195(2003)

NCBI and Uniprot Product Information

• NCBI GI #: 147639154
• UniProt Accession #: Q6PSU2; Q647H0; Q6PSU1; Q7Y1C0; Q84TU1; Q8GV20; Q941R0; A1DZE8; A5Z1R1; C0LJJ1
• Molecular Weight: 22 kDa
• NCBI Official Full Name: Conglutin-7
• UniProt Protein Name: Conglutin-7
• UniProt Entry Name: CONG7_ARAHY