CoV-MERS spike-RBD Recombinant Protein | CoV-MERS recombinant protein
CoV-MERS spike-RBD
Applications
ELISA, Western Blot
Purity
>95% pure (12% SDS-PAGE, Coomassie blue stain). Proprietary chromatographic technique.
Synonyms
CoV-MERS spike-RBD; N/A; CoV-MERS recombinant protein
Host
E Coli
Specificity
>95% pure (12% SDS-PAGE, Coomassie blue stain). Proprietary chromatographic technique.
Purity/Purification
>95% pure (12% SDS-PAGE, Coomassie blue stain). Proprietary chromatographic technique.
Form/Format
Purified, Liquid. PBS with 25mM arginin, 0.05% sodium azide
Concentration
1.73mg/ml (lot 04-2015) (varies by lot)
Sequence
EAKPSGSVVEQAEGVECDFSPLLSGTPPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPLSMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKLKYSYINKCSRLLSDDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQLQMGFGITVQYGTDTNSVCPKLEFANDTKIASQLGNCVEY
Applicable Applications for CoV-MERS recombinant protein
ELISA (EIA), Western Blot (WB), Immunoassay (IA)
Important Note
Centrifuge before opening to ensure complete recovery of vial contents.
Preparation and Storage
Upon receipt, store at -20 degree C. Avoid multiple freeze/thaw cycles.
SDS-PAGE
SDS-PAGE
Application Data
(Sequence)
Related Product Information for CoV-MERS recombinant protein
Since April 2012, cases of the Middle East Respiratory Syndrome Coronavirus (MERS-CoV) have been identified in middle east and other countries. This virus is also classified into coronaviruse family, causing severe illnesses with over 40% mortality.
Like other coronaviruses, large surface spike glycoprotein is one important structural protein of thisvirus, it is located over the virion surface to bind to and entry into the target cell. Sipke protein has two domains, S1 and S2, S1 domain is responsible for cellular tropism and interaction with target cell, while S2 domain responsible for membrane fusion. C terminus of S1 contains a receptor binding domain with potential for vaccine development and identification.A peptide from amino acids 367 to 606 spike protein S1 is expressed and purified from E Coli, a 6 x His tag is attached to its C terminus.
Like other coronaviruses, large surface spike glycoprotein is one important structural protein of thisvirus, it is located over the virion surface to bind to and entry into the target cell. Sipke protein has two domains, S1 and S2, S1 domain is responsible for cellular tropism and interaction with target cell, while S2 domain responsible for membrane fusion. C terminus of S1 contains a receptor binding domain with potential for vaccine development and identification.A peptide from amino acids 367 to 606 spike protein S1 is expressed and purified from E Coli, a 6 x His tag is attached to its C terminus.
Product Categories/Family for CoV-MERS recombinant protein
