Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA14639_SDS_PAGE3.jpg SDS-PAGE

CoV-MERS spike-RBD Recombinant Protein | CoV-MERS recombinant protein

CoV-MERS spike-RBD

Applications
ELISA, Western Blot
Purity
>95% pure (12% SDS-PAGE, Coomassie blue stain). Proprietary chromatographic technique.
Synonyms
CoV-MERS spike-RBD; N/A; CoV-MERS recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Specificity
>95% pure (12% SDS-PAGE, Coomassie blue stain). Proprietary chromatographic technique.
Purity/Purification
>95% pure (12% SDS-PAGE, Coomassie blue stain). Proprietary chromatographic technique.
Form/Format
Purified, Liquid. PBS with 25mM arginin, 0.05% sodium azide
Concentration
1.73mg/ml (lot 04-2015) (varies by lot)
Sequence
EAKPSGSVVEQAEGVECDFSPLLSGTPPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPLSMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKLKYSYINKCSRLLSDDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQLQMGFGITVQYGTDTNSVCPKLEFANDTKIASQLGNCVEY
Applicable Applications for CoV-MERS recombinant protein
ELISA (EIA), Western Blot (WB), Immunoassay (IA)
Important Note
Centrifuge before opening to ensure complete recovery of vial contents.
Preparation and Storage
Upon receipt, store at -20 degree C. Avoid multiple freeze/thaw cycles.

SDS-PAGE

product-image-AAA14639_SDS_PAGE3.jpg SDS-PAGE

SDS-PAGE

product-image-AAA14639_SDS_PAGE2.jpg SDS-PAGE

Application Data

(Sequence)

product-image-AAA14639_APP.jpg Application Data (Sequence)
Related Product Information for CoV-MERS recombinant protein
Since April 2012, cases of the Middle East Respiratory Syndrome Coronavirus (MERS-CoV) have been identified in middle east and other countries. This virus is also classified into coronaviruse family, causing severe illnesses with over 40% mortality.
Like other coronaviruses, large surface spike glycoprotein is one important structural protein of thisvirus, it is located over the virion surface to bind to and entry into the target cell. Sipke protein has two domains, S1 and S2, S1 domain is responsible for cellular tropism and interaction with target cell, while S2 domain responsible for membrane fusion. C terminus of S1 contains a receptor binding domain with potential for vaccine development and identification.A peptide from amino acids 367 to 606 spike protein S1 is expressed and purified from E Coli, a 6 x His tag is attached to its C terminus.
Product Categories/Family for CoV-MERS recombinant protein

Similar Products

Product Notes

The CoV-MERS (Catalog #AAA14639) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's CoV-MERS spike-RBD can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB), Immunoassay (IA). Researchers should empirically determine the suitability of the CoV-MERS for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: EAKPSGSVVE QAEGVECDFS PLLSGTPPQV YNFKRLVFTN CNYNLTKLLS LFSVNDFTCS QISPAAIASN CYSSLILDYF SYPLSMKSDL SVSSAGPISQ FNYKQSFSNP TCLILATVPH NLTTITKLKY SYINKCSRLL SDDRTEVPQL VNANQYSPCV SIVPSTVWED GDYYRKQLSP LEGGGWLVAS GSTVAMTEQL QMGFGITVQY GTDTNSVCPK LEFANDTKIA SQLGNCVEY. It is sometimes possible for the material contained within the vial of "CoV-MERS spike-RBD, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.