Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA62224_SDS_PAGE15.jpg SDS-PAGE (Purified recombinant spike RBD (K417T, E484K, N501Y) protein of SARS-CoV-2 Brazil variant)

COVID 19 Spike RBD Brazil Variant Coronavirus Recombinant Protein | COVID-19 recombinant protein

Recombinant Spike RBD Protein of SARS-CoV-2 Brazil Variant

Applications
ELISA, Western Blot
Purity
> 95% (by SDS-PAGE)
Synonyms
COVID 19 Spike RBD Brazil Variant Coronavirus; N/A; Recombinant Spike RBD Protein of SARS-CoV-2 Brazil Variant; 2019 Novel Coronavirus; Coronavirus; CoV; COVID-19 virus; HCoV-2; Human Coronavirus 2019; SARS2; SARS-CoV-2; Severe acute respiratory syndrome coronavirus 2; Spike RBD Brazil Variant; COVID-19 recombinant protein
Ordering
Host
HEK293 Cells
Purity/Purification
> 95% (by SDS-PAGE)
Concentration
1 ug/ul in PBS (varies by lot)
Sequence
RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGTIADYNYKLPDDFTGCVIAWNSNNLDSKVGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVKGFNCYFPLQSYGFQPTYGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF
Applicable Applications for COVID-19 recombinant protein
ELISA, WB (Western Blot)
Host Note
Glycosylated recombinant viral protein expressed and purified from HEK293 cells
Viral Protein
Spike RBD domain protein of human SARS-CoV-2 Brazil variant (GISAID No. EPI_ISL_833172) with a C-terminal His-tag
Endotoxin Level
<0.1 EU per ug of purified protein by LAL test
Dry Ice Shipment
Extra charge fee may add to your shipping cost as dry ice is required to ship this product.
Preparation and Storage
Store at -20°C. Stable for 3 months from the date of shipment when kept at 4°C. Non-hazardous, no MSDS required.

SDS-PAGE

(Purified recombinant spike RBD (K417T, E484K, N501Y) protein of SARS-CoV-2 Brazil variant)

product-image-AAA62224_SDS_PAGE15.jpg SDS-PAGE (Purified recombinant spike RBD (K417T, E484K, N501Y) protein of SARS-CoV-2 Brazil variant)
Related Product Information for COVID-19 recombinant protein
Description: Recombinant spike RBD (K417T, E484K, N501Y) protein of SARS-CoV-2 Brazil variant (B.1.1.248) expressed and purified from HEK293 cells. The binding activity has been tested using human ACE2 protein in a functional ELISA assay.

Introduction: Severe acute respiratory syndrome coronavirus 2 (SARS?CoV?2) is the virus that causes COVID-19 (coronavirus disease 2019), the respiratory illness responsible for the COVID-19 pandemic. Many SARS-CoV-2 variants have been identified throughout the world since it’s outbreak in late 2019; some are believed or have been believed to be of particular importance due to their potential for increased transmissibility, increased virulence, and reduced effectiveness of vaccines against them.

The genome of SARS-CoV-2 has 89% nucleotide identity with bat SARS-like-CoVZXC21 and 82% with that of human SARS-CoV. The phylogenetic trees of their orf1a/b, Spike, Envelope, Membrane and Nucleoprotein also clustered closely with those of the bat, civet and human SARS coronaviruses. However, the external subdomain of Spike's receptor binding domain (RBD) of SARS-CoV-2 shares only 40% amino acid identity with other SARS-related coronaviruses.

Similar Products

Product Notes

The COVID-19 (Catalog #AAA62224) is a Recombinant Protein produced from HEK293 Cells and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's COVID 19 Spike RBD Brazil Variant Coronavirus can be used in a range of immunoassay formats including, but not limited to, ELISA, WB (Western Blot). Researchers should empirically determine the suitability of the COVID-19 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: RVQPTESIVR FPNITNLCPF GEVFNATRFA SVYAWNRKRI SNCVADYSVL YNSASFSTFK CYGVSPTKLN DLCFTNVYAD SFVIRGDEVR QIAPGQTGTI ADYNYKLPDD FTGCVIAWNS NNLDSKVGNY NYLYRLFRKS NLKPFERDIS TEIYQAGSTP CNGVKGFNCY FPLQSYGFQP TYGVGYQPYR VVVLSFELLH APATVCGPKK STNLVKNKCV NF. It is sometimes possible for the material contained within the vial of "COVID 19 Spike RBD Brazil Variant Coronavirus, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.