Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201835_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: FAM35ASample Type: Lung Tumor lysatesAntibody Dilution: 1.0ug/ml)

SHLD2 blocking peptide

SHLD2 Peptide - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
SHLD2; RINN2; FAM35A; FAM35A1; bA163M19.1
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Guinea Pig, Horse, Pig, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SHLD2; N/A; SHLD2 Peptide - C-terminal region; RINN2, FAM35A, FAM35A1, bA163M19.1; SHLD2 blocking peptide
Ordering
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Guinea Pig, Horse, Pig, Rabbit
Purity/Purification
Affinity Purified
Form/Format
Lyophilized powder
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: SSEITYGMVVADLFHSLLAVSAEPCVLKIQSLFVLDENSYPLQQDFSLLD
Sequence Length
835
Applicable Applications for SHLD2 blocking peptide
WB (Western Blot)
Protein Size (# AA)
835 amino acids
Protein Interactions
UBC;
Blocking Peptide
For anti-SHLD2 ( ) antibody is Catalog # MBS3238244
Predicted Homology
Based on Immunogen Sequence: Cow: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: FAM35ASample Type: Lung Tumor lysatesAntibody Dilution: 1.0ug/ml)

product-image-AAA201835_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: FAM35ASample Type: Lung Tumor lysatesAntibody Dilution: 1.0ug/ml)
Product Categories/Family for SHLD2 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
91kDa
NCBI Official Full Name
shieldin complex subunit 2 isoform 2
NCBI Official Synonym Full Names
shieldin complex subunit 2
NCBI Official Symbol
SHLD2
NCBI Official Synonym Symbols
RINN2; FAM35A; FAM35A1; bA163M19.1
NCBI Protein Information
shieldin complex subunit 2; protein FAM35A
UniProt Protein Name
Protein FAM35A
UniProt Gene Name
FAM35A

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The SHLD2 fam35a (Catalog #AAA201835) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The SHLD2 Peptide - C-terminal region reacts with Tested Species Reactivity: Human Predicted Species Reactivity: Human, Mouse, Rat, Cow, Guinea Pig, Horse, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's SHLD2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the SHLD2 fam35a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SSEITYGMVV ADLFHSLLAV SAEPCVLKIQ SLFVLDENSY PLQQDFSLLD. It is sometimes possible for the material contained within the vial of "SHLD2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.