SDS-PAGE
Cellular retinoic acid-binding protein 1 Recombinant Protein | CRABP1 recombinant protein
Recombinant Human Cellular retinoic acid-binding protein 1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cellular retinoic acid-binding protein 1; N/A; Recombinant Human Cellular retinoic acid-binding protein 1; Cellular retinoic acid-binding protein I; CRABP-I; CRABP1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-137aa; Full Length
Sequence
PNFAGTWKMRSSENFDELLKALGVNAMLRKVAVAAASKPHVEIRQDGDQFYIKTSTTVRTTEINFKVGEGFEEETVDGRKCRSLPTWENENKIHCTQTLLEGDGPKTYWTRELANDELILTFGADDVVCTRIYVRE
Sequence Length
137
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for CRABP1 recombinant protein
Cytosolic CRABPs may regulate the access of retinoic acid to the nuclear retinoic acid receptors.
Product Categories/Family for CRABP1 recombinant protein
References
Isolation and characterization of a cDNA clone corresponding to bovine cellular retinoic-acid-binding protein and chromosomal localization of the corresponding human gene.Nilsson M.H.L., Spurr N.K., Saksena P., Busch C., Nordlinder H., Peterson P.A., Rask L., Sundelin J.Eur. J. Biochem. 173:45-51(1988) Molecular cloning and analysis of functional cDNA and genomic clones encoding bovine cellular retinoic acid-binding protein.Shubeita H.E., Sambrook J.F., McCormick A.M.Proc. Natl. Acad. Sci. U.S.A. 84:5645-5649(1987) Cellular retinoic acid- and cellular retinol-binding proteins complementary deoxyribonucleic acid cloning, chromosomal assignment, and tissue specific expression.Wei L.-N., Mertz J.R., Goodman D.S., Nguyen-Huu M.C.Mol. Endocrinol. 1:526-534(1987) Bovine cellular retinoic acid binding protein 1.Jeong Y.-H., Lee S.-M., Park H.-Y., Kim H.-M., Yoon D.-H., Chung E.-R., Kang M.-J.NIH - Mammalian Gene Collection (MGC) project The primary structure of bovine cellular retinoic acid-binding protein.Sundelin J., Das S.R., Eriksson U., Rask L., Peterson P.A.J. Biol. Chem. 260:6494-6499(1985) N-terminal sequence homology among retinoid-binding proteins from bovine retina.Crabb J.W., Saari J.C.FEBS Lett. 130:15-18(1981) Crystal structures of cellular retinoic acid binding proteins I and II in complex with all-trans-retinoic acid and a synthetic retinoid.Kleywegt G.J., Bergfors T., Senn H., le Motte P., Gsell B., Shudo K., Jones T.A.Structure 2:1241-1258(1994) Structures of cellular retinoic acid binding proteins I and II in complex with synthetic retinoids.Chaudhuri B.N., Kleywegt G.J., Broutin-L'Hermite I., Bergfors T., Senn H., Le Motte P., Partouche O., Jones T.A.Acta Crystallogr. D 55:1850-1857(1999)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
42.5 kDa
NCBI Official Full Name
cellular retinoic acid-binding protein 1
NCBI Official Symbol
CRABP1
NCBI Protein Information
cellular retinoic acid-binding protein 1
UniProt Protein Name
Cellular retinoic acid-binding protein 1
UniProt Gene Name
CRABP1
UniProt Synonym Gene Names
CRABP-I
UniProt Entry Name
RABP1_BOVIN
Similar Products
Product Notes
The CRABP1 crabp1 (Catalog #AAA113245) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-137aa; Full Length. The amino acid sequence is listed below: PNFAGTWKMR SSENFDELLK ALGVNAMLRK VAVAAASKPH VEIRQDGDQF YIKTSTTVRT TEINFKVGEG FEEETVDGRK CRSLPTWENE NKIHCTQTLL EGDGPKTYWT RELANDELIL TFGADDVVCT RIYVRE. It is sometimes possible for the material contained within the vial of "Cellular retinoic acid-binding protein 1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.