Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA283403_AD13.jpg Application Data (Immobilized Human CRTAM, His Tag at 0.5ug/ml (100ul/Well) on the plate. Dose response curve for Anti-CRTAM Antibody, hFc Tag with the EC<sub>50</sub> of 57.3ng/ml determined by ELISA.)

CRTAM/CD355 (A65V) Recombinant Protein | CRTAM recombinant protein

Recombinant Human CRTAM/CD355 (A65V) Protein

Average rating 0.0
No ratings yet
Purity
>95% by SDS-PAGE.
Synonyms
CRTAM/CD355 (A65V); N/A; Recombinant Human CRTAM/CD355 (A65V) Protein; CD355 antigen; CD355; CRTAM; CRTAM recombinant protein
Ordering
Host
HEK293 cells
Purity/Purification
>95% by SDS-PAGE.
Sequence
LTNHTETITVEEGQTLTLKCVTSLRKNSSLQWLTPSGFTIFLNEYPVLKNSKYQLLHHSANQLSITVPNVTLQDEGVYKCLHYSDSVSTKEVKVIVLATPFKPILEASVIRKQNGEEHVVLMCSTMRSKPPPQITWLLGNSMEVSGGTLHEFETDGKKCNTTSTLIIHTYGKNSTVDCIIRHRGLQGRKLVAPFRFEDLVTDEETASDALERNSLSSQDPQQPTSTVSVTEDSSTSEIDKEEKEQTTQDPDLTTEANPQYLGLARKKSG
Species
Human
Tag
C-His
Endotoxin
<0.01EU/ug by the LAL method.
Preparation and Storage
Store at -20 degree C. Store the lyophilized protein at -20 degree C to -80 degree C up to 1 year from the date of receipt.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

Application Data

(Immobilized Human CRTAM, His Tag at 0.5ug/ml (100ul/Well) on the plate. Dose response curve for Anti-CRTAM Antibody, hFc Tag with the EC<sub>50</sub> of 57.3ng/ml determined by ELISA.)

product-image-AAA283403_AD13.jpg Application Data (Immobilized Human CRTAM, His Tag at 0.5ug/ml (100ul/Well) on the plate. Dose response curve for Anti-CRTAM Antibody, hFc Tag with the EC<sub>50</sub> of 57.3ng/ml determined by ELISA.)

SDS-PAGE

(Recombinant Human CRTAM Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 45-65 kDa.)

product-image-AAA283403_SDS_PAGE15.jpg SDS-PAGE (Recombinant Human CRTAM Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 45-65 kDa.)
Related Product Information for CRTAM recombinant protein
Class-I Restricted T Cell-Associated Molecule (CRTAM) is a protein that is expressed after T cell activation. The interaction of CRTAM with its ligand, nectin-like 2 (Necl2), is required for the efficient production of IL-17, IL-22, and IFNgamma by murine CD4 T cells, and it plays a role in optimal CD8 T and NK cell cytotoxicity. CRTAM promotes the pro-inflammatory cytokine profile; therefore, it may take part in the immunopathology of autoimmune diseases such as diabetes type 1 or colitis.
Product Categories/Family for CRTAM recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
UniProt Protein Name
Cytotoxic and regulatory T-cell molecule
UniProt Gene Name
CRTAM
UniProt Entry Name
CRTAM_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CRTAM crtam (Catalog #AAA283403) is a Recombinant Protein produced from HEK293 cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: LTNHTETITV EEGQTLTLKC VTSLRKNSSL QWLTPSGFTI FLNEYPVLKN SKYQLLHHSA NQLSITVPNV TLQDEGVYKC LHYSDSVSTK EVKVIVLATP FKPILEASVI RKQNGEEHVV LMCSTMRSKP PPQITWLLGN SMEVSGGTLH EFETDGKKCN TTSTLIIHTY GKNSTVDCII RHRGLQGRKL VAPFRFEDLV TDEETASDAL ERNSLSSQDP QQPTSTVSVT EDSSTSEIDK EEKEQTTQDP DLTTEANPQY LGLARKKSG. It is sometimes possible for the material contained within the vial of "CRTAM/CD355 (A65V), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.