Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA283352_AD13.jpg Application Data (Recombinant Rat CSF-1/M-CSF stimulates cell proliferation assay using M-NFS-60 mouse myelogenous leukemia lymphoblast cells. The ED<sub>50</sub> for this effect is 5.63-22.51 ng/mL, corresponding to a specific activity of 4.44×10<sup>4</sup>~1.78×10<sup>5</sup> units/mg.)

CSF-1/M-CSF recombinant protein

Recombinant Rat CSF-1/M-CSF Protein

Average rating 0.0
No ratings yet
Synonyms
CSF-1/M-CSF; N/A; Recombinant Rat CSF-1/M-CSF Protein; Macrophage colony-stimulating factor 1, CSF-1, MCSF, Proteoglycan macrophage colony-stimulating factor, PG-M-CSF, Cleaved into: Processed macrophage colony-stimulating factor 1, Macrophage colony-stimulating factor 1 43 kDa subunit, Csf1, Csfm; CSF-1/M-CSF recombinant protein
Ordering
Host
HEK293 cells
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH7.4.
Sequence
PSSTWMGSRLLLVCLLVSRSVAEVSEHCSHMIGNGHLQILQQLIDSQMETACLIEYKFVDQEQLDDPVCYLKKAFVLVQVIIEETMRFKDNTPNANATERLQELSMKLNSCFIKDYKEQNEACVQTYKESPLRLLEKIKNFFNETKNFLEKDWNIFSKNCNDSFAKCSSRDVVTKPDCNCLYPKATPSSDLASASPHQPPAPSMAPLADLAWDDSQRTEGSSLLPSDLPLRIEDPGSAKQRPPRS
Species
Rat
Tag
C-His
Endotoxin
<0.1EU/ug of the protein by LAL method.
Bio-Activity
Measured in a cell proliferation assay using M-NFS-60 mouse myelogenous leukemia lymphoblast cells. The ED50 for this effect is 5.63-22.51ng/mL, corresponding to a specific activity of 4.44×104~1.78×105 units/mg.
Preparation and Storage
Store at -20 degree C. Store the lyophilized protein at -20 degree C to -80 degree C up to 1 year from the date of receipt.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

Application Data

(Recombinant Rat CSF-1/M-CSF stimulates cell proliferation assay using M-NFS-60 mouse myelogenous leukemia lymphoblast cells. The ED<sub>50</sub> for this effect is 5.63-22.51 ng/mL, corresponding to a specific activity of 4.44×10<sup>4</sup>~1.78×10<sup>5</sup> units/mg.)

product-image-AAA283352_AD13.jpg Application Data (Recombinant Rat CSF-1/M-CSF stimulates cell proliferation assay using M-NFS-60 mouse myelogenous leukemia lymphoblast cells. The ED<sub>50</sub> for this effect is 5.63-22.51 ng/mL, corresponding to a specific activity of 4.44×10<sup>4</sup>~1.78×10<sup>5</sup> units/mg.)

SDS-PAGE

(Recombinant Rat CSF-1/M-CSF Protein was resolved with SDS PAGE under reducing (R) and non-reducing (NR) conditions, showing single bands at 40-55 kDa and 75-110 kDa, respectively.)

product-image-AAA283352_SDS_PAGE15.jpg SDS-PAGE (Recombinant Rat CSF-1/M-CSF Protein was resolved with SDS PAGE under reducing (R) and non-reducing (NR) conditions, showing single bands at 40-55 kDa and 75-110 kDa, respectively.)
Related Product Information for CSF-1/M-CSF recombinant protein
Macrophage colony-stimulating factor (M-CSF), also known as colony-stimulating factor-1 (CSF-1), is a hemopoietic growth factor that regulates the survival, proliferation, differentiation and function of the cells of the mononuclear phagocyte lineage. M-CSF is produced by a variety of cell types and acts both locally and humorally in an autocrine and paracrine manner. Through differential mRNA splicing and posttranslational proteolytic processing and modification, M-CSF is expressed in three biologically-active isoforms: a secreted glycoprotein; a secreted proteoglycan; and a membrane spanning cell-surface glycoprotein.
Product Categories/Family for CSF-1/M-CSF recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
UniProt Protein Name
Macrophage colony-stimulating factor 1
UniProt Gene Name
Csf1
UniProt Synonym Gene Names
Csfm; CSF-1; MCSF
UniProt Entry Name
CSF1_RAT

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CSF-1/M-CSF csf1 (Catalog #AAA283352) is a Recombinant Protein produced from HEK293 cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: PSSTWMGSRL LLVCLLVSRS VAEVSEHCSH MIGNGHLQIL QQLIDSQMET ACLIEYKFVD QEQLDDPVCY LKKAFVLVQV IIEETMRFKD NTPNANATER LQELSMKLNS CFIKDYKEQN EACVQTYKES PLRLLEKIKN FFNETKNFLE KDWNIFSKNC NDSFAKCSSR DVVTKPDCNC LYPKATPSSD LASASPHQPP APSMAPLADL AWDDSQRTEG SSLLPSDLPL RIEDPGSAKQ RPPRS. It is sometimes possible for the material contained within the vial of "CSF-1/M-CSF, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.