CSF-1/M-CSF recombinant protein

Recombinant Mouse CSF-1/M-CSF Protein

Cat. Num. AAA283357

• Synonyms: CSF-1/M-CSF; N/A; Recombinant Mouse CSF-1/M-CSF Protein; MCSF, M-CSF, CSF-1, Lanimostim, CSF1; CSF-1/M-CSF recombinant protein

• Host: HEK293 cells
• Form/Format: Lyophilized from a 0.22 um filtered solution of PBS, pH7.4.
• Sequence: MTARGAAGRCPSSTWLGSRLLLVCLLMSRSIAKEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKP

• Species: Mouse
• Endotoxin: <0.01 EU/ug of the protein by LAL method.
• Bio-Activity: Measured in a cell proliferation assay using M-NFS-60 mouse myelogenous leukemia lymphoblast cells. The ED₅₀ for this effect is 3.76-15.16ng/mL, corresponding to a specific activity of 6.6×10⁴~2.65×10⁵ units/mg.
• Preparation and Storage: Store at -20 degree C. Store the lyophilized protein at -20 degree C to -80 degree C up to 1 year from the date of receipt.; After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

Application Data

(Recombinant Mouse CSF-1/M-CSF stimulates cell proliferation assay using M-NFS-60 mouse myelogenous leukemia lymphoblast cells. The ED₅₀ for this effect is 3.76-15.16 ng/mL, corresponding to a specific activity of 6.6×10⁴~2.65×10⁵ units/mg.)

SDS-PAGE

(Recombinant Mouse CSF-1/M-CSF Protein was resolved with SDS PAGE under reducing (R) and non-reducing (NR) conditions ?showing single bands at 20-25 kDa and 35-45 kDa, respectively.)

Related Product Information for CSF-1/M-CSF recombinant protein

Macrophage colony-stimulating factor 1, also known as CSF-1, M-CSF, is a single-pass membrane protein which is disulfide-linked as a homodimer or heterodimer. Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. M-CSF/CSF-1 is known to facilitate monocyte survival, monocyte-to-macrophage conversion, and macrophage proliferation. M-CSF/CSF-1 is a secreted cytokine which influences hemopoietic stem cells to differentiate into macrophages or other related cell types. It binds to the Colony stimulating factor 1 receptor. M-CSF/CSF-1 may also be involved in development of the placenta. The active form of M-CSF/CSF-1 is found extracellularly as a disulfide-linked homodimer, and is thought to be produced by proteolytic cleavage of membrane-bound precursors. M-CSF/CSF-1 induces cells of the monocyte/macrophage lineage. It also plays a role in immunological defenses, bone metabolism, lipoproteins clearance, fertility and pregnancy. Upregulation of M-CSF/CSF-1 in the infarcted myocardium may have an active role in healing not only through its effects on cells of monocyte/macrophage lineage, but also by regulating endothelial cell chemokine expression.

Product Categories/Family for CSF-1/M-CSF recombinant protein

Cytokines & Cytokine receptors ; Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 166064046
• NCBI GeneID: 12977
• NCBI Accession #: NP_001107001.1
• NCBI GenBank Nucleotide #: NM_001113529.1
• UniProt Accession #: P07141; Q3U395; Q8R3C8
• UniProt Protein Name: Macrophage colony-stimulating factor 1
• UniProt Gene Name: Csf1
• UniProt Synonym Gene Names: Csfm; CSF-1; MCSF
• UniProt Entry Name: CSF1_MOUSE