Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA283357_AD13.jpg Application Data (Recombinant Mouse CSF-1/M-CSF stimulates cell proliferation assay using M-NFS-60 mouse myelogenous leukemia lymphoblast cells. The ED<sub>50</sub> for this effect is 3.76-15.16 ng/mL, corresponding to a specific activity of 6.6×10<sup>4</sup>~2.65×10<sup>5</sup> units/mg.)

CSF-1/M-CSF recombinant protein

Recombinant Mouse CSF-1/M-CSF Protein

Average rating 0.0
No ratings yet
Synonyms
CSF-1/M-CSF; N/A; Recombinant Mouse CSF-1/M-CSF Protein; MCSF, M-CSF, CSF-1, Lanimostim, CSF1; CSF-1/M-CSF recombinant protein
Ordering
Host
HEK293 cells
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH7.4.
Sequence
MTARGAAGRCPSSTWLGSRLLLVCLLMSRSIAKEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKP
Species
Mouse
Endotoxin
<0.01 EU/ug of the protein by LAL method.
Bio-Activity
Measured in a cell proliferation assay using M-NFS-60 mouse myelogenous leukemia lymphoblast cells. The ED50 for this effect is 3.76-15.16ng/mL, corresponding to a specific activity of 6.6×104~2.65×105 units/mg.
Preparation and Storage
Store at -20 degree C. Store the lyophilized protein at -20 degree C to -80 degree C up to 1 year from the date of receipt.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

Application Data

(Recombinant Mouse CSF-1/M-CSF stimulates cell proliferation assay using M-NFS-60 mouse myelogenous leukemia lymphoblast cells. The ED<sub>50</sub> for this effect is 3.76-15.16 ng/mL, corresponding to a specific activity of 6.6×10<sup>4</sup>~2.65×10<sup>5</sup> units/mg.)

product-image-AAA283357_AD13.jpg Application Data (Recombinant Mouse CSF-1/M-CSF stimulates cell proliferation assay using M-NFS-60 mouse myelogenous leukemia lymphoblast cells. The ED<sub>50</sub> for this effect is 3.76-15.16 ng/mL, corresponding to a specific activity of 6.6×10<sup>4</sup>~2.65×10<sup>5</sup> units/mg.)

SDS-PAGE

(Recombinant Mouse CSF-1/M-CSF Protein was resolved with SDS PAGE under reducing (R) and non-reducing (NR) conditions ?showing single bands at 20-25 kDa and 35-45 kDa, respectively.)

product-image-AAA283357_SDS_PAGE15.jpg SDS-PAGE (Recombinant Mouse CSF-1/M-CSF Protein was resolved with SDS PAGE under reducing (R) and non-reducing (NR) conditions ?showing single bands at 20-25 kDa and 35-45 kDa, respectively.)
Related Product Information for CSF-1/M-CSF recombinant protein
Macrophage colony-stimulating factor 1, also known as CSF-1, M-CSF, is a single-pass membrane protein which is disulfide-linked as a homodimer or heterodimer. Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. M-CSF/CSF-1 is known to facilitate monocyte survival, monocyte-to-macrophage conversion, and macrophage proliferation. M-CSF/CSF-1 is a secreted cytokine which influences hemopoietic stem cells to differentiate into macrophages or other related cell types. It binds to the Colony stimulating factor 1 receptor. M-CSF/CSF-1 may also be involved in development of the placenta. The active form of M-CSF/CSF-1 is found extracellularly as a disulfide-linked homodimer, and is thought to be produced by proteolytic cleavage of membrane-bound precursors. M-CSF/CSF-1 induces cells of the monocyte/macrophage lineage. It also plays a role in immunological defenses, bone metabolism, lipoproteins clearance, fertility and pregnancy. Upregulation of M-CSF/CSF-1 in the infarcted myocardium may have an active role in healing not only through its effects on cells of monocyte/macrophage lineage, but also by regulating endothelial cell chemokine expression.
Product Categories/Family for CSF-1/M-CSF recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
UniProt Protein Name
Macrophage colony-stimulating factor 1
UniProt Gene Name
Csf1
UniProt Synonym Gene Names
Csfm; CSF-1; MCSF
UniProt Entry Name
CSF1_MOUSE

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CSF-1/M-CSF csf1 (Catalog #AAA283357) is a Recombinant Protein produced from HEK293 cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MTARGAAGRC PSSTWLGSRL LLVCLLMSRS IAKEVSEHCS HMIGNGHLKV LQQLIDSQME TSCQIAFEFV DQEQLDDPVC YLKKAFFLVQ DIIDETMRFK DNTPNANATE RLQELSNNLN SCFTKDYEEQ NKACVRTFHE TPLQLLEKIK NFFNETKNLL EKDWNIFTKN CNNSFAKCSS RDVVTKP. It is sometimes possible for the material contained within the vial of "CSF-1/M-CSF, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.