Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA113741_SDS_PAGE15.jpg SDS-PAGE

Casein kinase II subunit beta (CSNK2B) Recombinant Protein | CSNK2B recombinant protein

Recombinant Human Casein kinase II subunit beta (CSNK2B)

Average rating 0.0
No ratings yet
Gene Names
CSNK2B; G5A; CK2B; CK2N; Ckb1; Ckb2; CSK2B
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Casein kinase II subunit beta (CSNK2B); N/A; Recombinant Human Casein kinase II subunit beta (CSNK2B); CSNK2B recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-215, Full length protein
Sequence
SSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR
Sequence Length
214
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

product-image-AAA113741_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for CSNK2B recombinant protein
This gene encodes the beta subunit of casein kinase II, a ubiquitous protein kinase which regulates metabolic pathways, signal transduction, transcription, translation, and replication. The enzyme is composed of three subunits, alpha, alpha prime and beta, which form a tetrameric holoenzyme. The alpha and alpha prime subunits are catalytic, while the beta subunit serves regulatory functions. The enzyme localizes to the endoplasmic reticulum and the Golgi apparatus.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24,942 Da
NCBI Official Full Name
casein kinase II subunit beta isoform 2
NCBI Official Synonym Full Names
casein kinase 2 beta
NCBI Official Symbol
CSNK2B
NCBI Official Synonym Symbols
G5A; CK2B; CK2N; Ckb1; Ckb2; CSK2B
NCBI Protein Information
casein kinase II subunit beta
UniProt Protein Name
Casein kinase II subunit beta
UniProt Gene Name
CSNK2B
UniProt Synonym Gene Names
CK2N; G5A; CK II beta

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CSNK2B csnk2b (Catalog #AAA113741) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-215, Full length protein. The amino acid sequence is listed below: SSSEEVSWIS WFCGLRGNEF FCEVDEDYIQ DKFNLTGLNE QVPHYRQALD MILDLEPDEE LEDNPNQSDL IEQAAEMLYG LIHARYILTN RGIAQMLEKY QQGDFGYCPR VYCENQPMLP IGLSDIPGEA MVKLYCPKCM DVYTPKSSRH HHTDGAYFGT GFPHMLFMVH PEYRPKRPAN QFVPRLYGFK IHPMAYQLQL QAASNFKSPV KTIR. It is sometimes possible for the material contained within the vial of "Casein kinase II subunit beta (CSNK2B), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.