Cathepsin B Recombinant Protein | CTSB recombinant protein

Recombinant Human Cathepsin B Protein

Cat. Num. AAA283410

• Purity: >97% by SDS-PAGE.
• Synonyms: Cathepsin B; N/A; Recombinant Human Cathepsin B Protein; Cathepsin B, 3.4.22.1, APP secretase, APPS, Cathepsin B1, CTSB; CTSB recombinant protein

• Host: HEK293 Cells
• Purity/Purification: >97% by SDS-PAGE.
• Form/Format: Lyophilized from a 0.22 um filtered solution of PBS, pH7.4.
• Sequence: RSRPSFHPLSDELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTDQYWEKI

• Species: Human
• Tag: C-His
• Endotoxin: <0.1EU/ug
• Bio-Activity: Measured by its ability to cleave the fluorogenic peptide substrate Z-LR-AMC (R&D Systems,#ES008). The specific activity is >3468 pmoles/min/ug.
• Preparation and Storage: Store at -20 degree C. Store the lyophilized protein at -20 degree C to -80 degree C up to 1 year from the date of receipt.; After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

Application Data

(Recombinant Human Cathepsin B cleave the fluorogenic peptide substrate Z-LR-AMC . The specific activity is >3468 pmoles/min/ug.)

SDS-PAGE

(Recombinant Human Cathepsin B Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 40-50 kDa.)

Related Product Information for CTSB recombinant protein

Cathepsin B is a papain-family cysteine protease that is normally located in lysosomes, where it is involved in the turnover of proteins and plays various roles in maintaining the normal metabolism of cells. This protease has been implicated in pathological conditions, e.g., tumor progression and arthritis. In disease conditions, increases in the expression of cathepsin B occur at both the gene and protein levels. Cathepsin B is synthesized as a preproenzyme and the primary pathways for its normal trafficking to the lysosome utilize mannose 6-phosphate receptors (MPRs). Mature cathepsin B has the ability to degrade several extracellular matrix components at both neutral and acidic pHand has been implicated in the progression of several human and rodent tumors progression and arthritis. Cathepsin B expression is increased in many human cancers at the mRNA, protein and activity levels. It is also frequently overexpressed in premalignant lesions, an observation that associates this protease with local invasive stages of cancer. Increased expression of cathepsin B in primary cancers, and especially in preneoplastic lesions, suggests that this enzyme might have pro-apoptotic features. Active cathepsin B is also secreted from tumours, a mechanism likely to be facilitated by lysosomal exocytosis or extracellular processing by surface activators. Cathepsin B is localized to caveolae on the tumour surface, where binding to the annexin II heterotetramer occurs. Thus CTSB is suggested as a tumor marker. Additionally, Cathepsin B can degrade extracellular matrix proteins, such as collagen IV and laminin, and can activate the precursor form of urokinase plasminogen activator (uPA), perhaps thereby initiating an extracellular proteolytic cascade.

Product Categories/Family for CTSB recombinant protein

Other Recombinant Protein; Proteins

NCBI and Uniprot Product Information

• NCBI GeneID: 1508
• UniProt Accession #: P07858
• UniProt Protein Name: Cathepsin B
• UniProt Gene Name: CTSB
• UniProt Synonym Gene Names: CPSB; APPS
• UniProt Entry Name: CATB_HUMAN