Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Cathepsin D (CTSD) Recombinant Protein | CTSD recombinant protein

Recombinant Human Cathepsin D (CTSD), Partial

Average rating 0.0
No ratings yet
Gene Names
CTSD; CPSD; CLN10; HEL-S-130P
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cathepsin D (CTSD); N/A; Recombinant Human Cathepsin D (CTSD), Partial; CTSD recombinant protein
Ordering
Host
E Coli
Specificity
Expressed in the aorta extracellular space (at protein level) (PubMed:20551380). Expressed in liver (at protein level) (PubMed:1426530).
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
67-403aa; Partial
Sequence
IPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNR
Species
Human
Tag
N-terminal 6xHis-tagged
Subcellular Location
Lysosome, Melanosome, Secreted, Extracellular Space
Protein Families
Peptidase A1 family
Pathway
Estrogen Signaling Pathway
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for CTSD recombinant protein
Acid protease active in intracellular protein breakdown. Involved in the pathogenesis of several diseases such as breast cancer and possibly Alzheimer disease.
Product Categories/Family for CTSD recombinant protein
References
Proteomic and bioinformatic characterization of the biogenesis and function of melanosomes.Chi A., Valencia J.C., Hu Z.-Z., Watabe H., Yamaguchi H., Mangini N.J., Huang H., Canfield V.A., Cheng K.C., Yang F., Abe R., Yamagishi S., Shabanowitz J., Hearing V.J., Wu C., Appella E., Hunt D.F.J. Proteome Res. 5:3135-3144(2006).

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40.8 kDa
NCBI Official Full Name
cathepsin D preproprotein
NCBI Official Synonym Full Names
cathepsin D
NCBI Official Symbol
CTSD
NCBI Official Synonym Symbols
CPSD; CLN10; HEL-S-130P
NCBI Protein Information
cathepsin D
UniProt Protein Name
Cathepsin D
UniProt Gene Name
CTSD
UniProt Synonym Gene Names
CPSD
UniProt Entry Name
CATD_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CTSD ctsd (Catalog #AAA235621) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 67-403aa; Partial. The amino acid sequence is listed below: IPEVLKNYMD AQYYGEIGIG TPPQCFTVVF DTGSSNLWVP SIHCKLLDIA CWIHHKYNSD KSSTYVKNGT SFDIHYGSGS LSGYLSQDTV SVPCQSASSA SALGGVKVER QVFGEATKQP GITFIAAKFD GILGMAYPRI SVNNVLPVFD NLMQQKLVDQ NIFSFYLSRD PDAQPGGELM LGGTDSKYYK GSLSYLNVTR KAYWQVHLDQ VEVASGLTLC KEGCEAIVDT GTSLMVGPVD EVRELQKAIG AVPLIQGEYM IPCEKVSTLP AITLKLGGKG YKLSPEDYTL KVSQAGKTLC LSGFMGMDIP PPSGPLWILG DVFIGRYYTV FDRDNNR. It is sometimes possible for the material contained within the vial of "Cathepsin D (CTSD), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.