Cathepsin F Recombinant Protein | CTSF recombinant protein

Recombinant Human Cathepsin F protein

Cat. Num. AAA81751

• Gene Names: CTSF; CATSF; CLN13
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Cathepsin F; N/A; Recombinant Human Cathepsin F protein; CTSF recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 273-484aa; partial
• Sequence: PEWDWRSKGAVTKVKDQGMCGSCWAFSVTGNVEGQWFLNQGTLLSLSEQELLDCDKMDKACMGGLPSNAYSAIKNLGGLETEDDYSYQGHMQSCNFSAEKAKVYINDSVELSQNEQKLAAWLAKRGPISVAINAFGMQFYRHGISRPLRPLCSPWLIDHAVLLVGYGNRSDVPFWAIKNSWGTDWGEKGYYYLHRGSGACGVNTMASSAVVD

• Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our or email to for more details.
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for CTSF recombinant protein

Thiol protease which is believed to participate in intracellular degradation and turnover of proteins. Has also been implicated in tumor invasion and metastasis.

Product Categories/Family for CTSF recombinant protein

Immunology

References

Molecular cloning and structural and functional characterization of human cathepsin F, a new cysteine proteinase of the papain family with a long propeptide domain.Santamaria I., Velasco G., Pendas A.M., Paz A., Lopez-Otin C.J. Biol. Chem. 274:13800-13809(1999) Full-length cDNA of human cathepsin F predicts the presence of a cystatin domain at the N-terminus of the cysteine protease zymogen.Naegler D.K., Sulea T., Menard R.Biochem. Biophys. Res. Commun. 257:313-318(1999) The human cathepsin F gene -- a fusion product between an ancestral cathepsin and cystatin gene.Wex T., Wex H., Broemme D.Biol. Chem. 380:1439-1442(1999) Human cathepsins F and W a new subgroup of cathepsins.Wex T., Levy B., Wex H., Bromme D.Biochem. Biophys. Res. Commun. 259:401-407(1999) Cathepsin F, a novel cysteine protease with an extremely long propeptide.Deussing J., Tisljar K., Papazoglou A., Peters C. Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) Human cathepsin F. Molecular cloning, functional expression, tissue localization, and enzymatic characterization.Wang B., Shi G.-P., Yao P.M., Li Z., Chapman H.A., Broemme D.J. Biol. Chem. 273:32000-32008(1998) The full-ORF clone resource of the German cDNA consortium.Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.BMC Genomics 8:399-399(2007) Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.J. Proteome Res. 8:651-661(2009) The crystal structure of human cathepsin F and its implications for the development of novel immunomodulators.Somoza J.R., Palmer J.T., Ho J.D.J. Mol. Biol. 322:559-568(2002) Cathepsin F mutations cause Type B Kufs disease, an adult-onset neuronal ceroid lipofuscinosis.Smith K.R., Dahl H.H., Canafoglia L., Andermann E., Damiano J., Morbin M., Bruni A.C., Giaccone G., Cossette P., Saftig P., Groetzinger J., Schwake M., Andermann F., Staropoli J.F., Sims K.B., Mole S.E., Franceschetti S., Alexander N.A., Cooper J.D., Chapman H.A., Carpenter S., Berkovic S.F., Bahlo M.Hum. Mol. Genet. 22:1417-1423(2013)

NCBI and Uniprot Product Information

• NCBI GI #: 6042196
• NCBI GeneID: 8722
• NCBI Accession #: NP_003784.2
• NCBI GenBank Nucleotide #: NM_003793.3
• UniProt Accession #: Q9UBX1; O95240; Q9NSU4; Q9UKQ5; B2R964
• Molecular Weight: 27.4 kDa
• NCBI Official Full Name: cathepsin F
• NCBI Official Synonym Full Names: cathepsin F
• NCBI Official Symbol: CTSF
• NCBI Official Synonym Symbols: CATSF; CLN13
• NCBI Protein Information: cathepsin F
• UniProt Protein Name: Cathepsin F
• UniProt Gene Name: CTSF
• UniProt Synonym Gene Names: CATSF
• UniProt Entry Name: CATF_HUMAN