Cathepsin Z (Ctsz) Recombinant Protein | Ctsz recombinant protein
Recombinant Rat Cathepsin Z (Ctsz)
Gene Names
Ctsz; CATX
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cathepsin Z (Ctsz); N/A; Recombinant Rat Cathepsin Z (Ctsz); Ctsz recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
64-306aa; Full Length of Mature Protein
Sequence
LPKNWDWRNVNGVNYASVTRNQHIPQYCGSCWAHGSTSALADRINIKRKGAWPSTLLSVQNVIDCGNAGSCEGGNDLPVWEYAHKHGIPDETCNNYQAKDQECDKFNQCGTCTEFKECHTIQNYTLWRVGDYGSLSGREKMMAEIYANGPISCGIMATERMSNYTGGIYTEYQNQAIINHIISVAGWGVSNDGIEYWIVRNSWGEPWGERGWMRIVTSTYKGGTGSSYNLAIEEACTFGDPIV
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Ctsz recombinant protein
This protein is a lysosomal cysteine proteinase and member of the peptidase C1 family. It exhibits both carboxy-monopeptidase and carboxy-dipeptidase activities. The encoded protein has also been known as cathepsin X and cathepsin P. This gene is expressed ubiquitously in cancer cell lines and primary tumors and, like other members of this family, may be involved in tumorigenesis.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
34,194 Da
NCBI Official Full Name
cathepsin Z
NCBI Official Synonym Full Names
cathepsin Z
NCBI Official Symbol
Ctsz
NCBI Official Synonym Symbols
CATX
NCBI Protein Information
cathepsin Z
UniProt Protein Name
Cathepsin Z
UniProt Gene Name
Ctsz
UniProt Synonym Gene Names
Ctsy
Similar Products
Product Notes
The Ctsz ctsz (Catalog #AAA117283) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 64-306aa; Full Length of Mature Protein. The amino acid sequence is listed below: LPKNWDWRNV NGVNYASVTR NQHIPQYCGS CWAHGSTSAL ADRINIKRKG AWPSTLLSVQ NVIDCGNAGS CEGGNDLPVW EYAHKHGIPD ETCNNYQAKD QECDKFNQCG TCTEFKECHT IQNYTLWRVG DYGSLSGREK MMAEIYANGP ISCGIMATER MSNYTGGIYT EYQNQAIINH IISVAGWGVS NDGIEYWIVR NSWGEPWGER GWMRIVTSTY KGGTGSSYNL AIEEACTFGD PIV. It is sometimes possible for the material contained within the vial of "Cathepsin Z (Ctsz), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.