C-X-C chemokine receptor type 3 (CXCR3) Recombinant Protein | CXCR3 recombinant protein
Recombinant Human C-X-C chemokine receptor type 3 (CXCR3), partial
Gene Names
CXCR3; GPR9; MigR; CD182; CD183; Mig-R; CKR-L2; CMKAR3; IP10-R
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
C-X-C chemokine receptor type 3 (CXCR3); N/A; Recombinant Human C-X-C chemokine receptor type 3 (CXCR3), partial; Recombinant Human C-X-C chemokine receptor type 3 (CXCR3) (His tagged); C-X-C chemokine receptor type 3; CXC-R3; CXCR-3; CKR-L2; G protein-coupled receptor 9; Interferon-inducible protein 10 receptor; IP-10 receptor; CD_antigen= CD183; CXCR3 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
4-50aa; Partial
Sequence
EVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLN
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
36.6 kDa
NCBI Official Full Name
C-X-C chemokine receptor type 3 isoform 2
NCBI Official Synonym Full Names
chemokine (C-X-C motif) receptor 3
NCBI Official Symbol
CXCR3
NCBI Official Synonym Symbols
GPR9; MigR; CD182; CD183; Mig-R; CKR-L2; CMKAR3; IP10-R
NCBI Protein Information
C-X-C chemokine receptor type 3; CXC-R3; CXCR-3; Mig receptor; IP10 receptor; IP-10 receptor; G protein-coupled receptor 9; chemokine (C-X-C) receptor 3; interferon-inducible protein 10 receptor
UniProt Protein Name
C-X-C chemokine receptor type 3
UniProt Gene Name
CXCR3
UniProt Synonym Gene Names
GPR9; CXC-R3; CXCR-3
UniProt Entry Name
CXCR3_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The CXCR3 cxcr3 (Catalog #AAA113248) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 4-50aa; Partial. The amino acid sequence is listed below: EVSDHQVLND AEVAALLENF SSSYDYGENE SDSCCTSPPC PQDFSLN. It is sometimes possible for the material contained within the vial of "C-X-C chemokine receptor type 3 (CXCR3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.