Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA113340_SDS_PAGE15.png SDS-PAGE

Cytochrome P450 11B2, mitochondrial (CYP11B2) Recombinant Protein | CYP11B2 recombinant protein

Recombinant Human Cytochrome P450 11B2, mitochondrial (CYP11B2)

Average rating 0.0
No ratings yet
Gene Names
CYP11B2; CPN2; ALDOS; CYP11B; CYP11BL; CYPXIB2; P450C18; P-450C18; P450aldo
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cytochrome P450 11B2, mitochondrial (CYP11B2); N/A; Recombinant Human Cytochrome P450 11B2, mitochondrial (CYP11B2); Cytochrome P450 11B2, mitochondrial; Aldosterone synthase; ALDOS; EC=1.14.15.4; EC=1.14.15.5; Aldosterone-synthesizing enzyme; CYPXIB2; Cytochrome P-450Aldo; Cytochrome P-450C18; Steroid 18-hydroxylase; CYP11B2 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
25-503; Full Length of Mature Protein
Sequence
GTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQGYEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFNRPQHYTGIVAELLLKAELSLEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQILRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPRPERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAIN
Sequence Length
503
Species
Homo sapiens (Human)
Production Note
Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our or email to for more details.
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

product-image-AAA113340_SDS_PAGE15.png SDS-PAGE
Related Product Information for CYP11B2 recombinant protein
Preferentially catalyzes the conversion of 11-deoxycorticosterone to aldosterone via corticosterone and 18-hydroxycorticosterone.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57 kDa
NCBI Official Full Name
cytochrome P450 11B2, mitochondrial
NCBI Official Synonym Full Names
cytochrome P450, family 11, subfamily B, polypeptide 2
NCBI Official Symbol
CYP11B2
NCBI Official Synonym Symbols
CPN2; ALDOS; CYP11B; CYP11BL; CYPXIB2; P450C18; P-450C18; P450aldo
NCBI Protein Information
cytochrome P450 11B2, mitochondrial; cytochrome P-450C18; aldosterone synthase; cytochrome P-450Aldo; steroid 11-beta-monooxygenase; steroid 11-beta/18-hydroxylase; aldosterone-synthesizing enzyme; steroid 18-hydroxylase, aldosterone synthase, P450C18, P450aldo; mitochondrial cytochrome P450, family 11, subfamily B, polypeptide 2; cytochrome P450, subfamily XIB (steroid 11-beta-hydroxylase), polypeptide 2
UniProt Protein Name
Cytochrome P450 11B2, mitochondrial
UniProt Gene Name
CYP11B2
UniProt Synonym Gene Names
ALDOS
UniProt Entry Name
C11B2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CYP11B2 cyp11b2 (Catalog #AAA113340) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 25-503; Full Length of Mature Protein. The amino acid sequence is listed below: GTRAARAPRT VLPFEAMPQH PGNRWLRLLQ IWREQGYEHL HLEMHQTFQE LGPIFRYNLG GPRMVCVMLP EDVEKLQQVD SLHPCRMILE PWVAYRQHRG HKCGVFLLNG PEWRFNRLRL NPDVLSPKAV QRFLPMVDAV ARDFSQALKK KVLQNARGSL TLDVQPSIFH YTIEASNLAL FGERLGLVGH SPSSASLNFL HALEVMFKST VQLMFMPRSL SRWISPKVWK EHFEAWDCIF QYGDNCIQKI YQELAFNRPQ HYTGIVAELL LKAELSLEAI KANSMELTAG SVDTTAFPLL MTLFELARNP DVQQILRQES LAAAASISEH PQKATTELPL LRAALKETLR LYPVGLFLER VVSSDLVLQN YHIPAGTLVQ VFLYSLGRNA ALFPRPERYN PQRWLDIRGS GRNFHHVPFG FGMRQCLGRR LAEAEMLLLL HHVLKHFLVE TLTQEDIKMV YSFILRPGTS PLLTFRAIN. It is sometimes possible for the material contained within the vial of "Cytochrome P450 11B2, mitochondrial (CYP11B2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.