Dermcidin Recombinant Protein | DCD recombinant protein

Recombinant Human Dermcidin

Cat. Num. AAA18431

• Gene Names: DCD; PIF; AIDD; DSEP; HCAP; DCD-1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Dermcidin; N/A; Recombinant Human Dermcidin; Preproteolysin; DCD recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 20-110aa; Full Length of Mature Protein
• Sequence: YDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRKQRSSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for DCD recombinant protein

DCD-1 displays antimicrobial activity thereby limiting skin infection by potential pathogens in the first few hours after bacterial colonization. Highly effective against E Coli, E. faecalis, S. aureus and C. albicans. Optimal pH and salt concentration resble the conditions in sweat. Also exhibits proteolytic activity. Survival-promoting peptide promotes survival of neurons and displays phosphatase activity. It may bind IgG.

Product Categories/Family for DCD recombinant protein

Signal Transduction

References

Dermcidin a novel human antibiotic peptide secreted by sweat glands.Schittek B., Hipfel R., Sauer B., Bauer J., Kalbacher H., Stevanovic S., Schirle M., Schroeder K., Blin N., Meier F., Rassner G., Garbe C.Nat. Immunol. 2:1133-1137(2001) Overexpression of new survival/evasion peptide (DSEP) attenuates retinoic acid responses and protects cells.Cunningham T.J., Jing H., Akerblom I., Morgan R., Fisher T.S., Neveu M.Genomic structure and chromosomal mapping of human preproteolysin gene.Tang X.D., Daggett H., Hoshi T.Structural and functional homologies of human proteolysis inducing factor.Lowrie A.G., Wigmore S.J., Deans D.A.C., Fearon K.C.H., Waddell I., Ross J.A.Identification of dermcidin in human gestational tissue and characterization of its proteolytic activity.Lee Motoyama J.P., Kim-Motoyama H., Kim P., Nakagama H., Miyagawa K., Suzuki K.Biochem. Biophys. Res. Commun. 357:828-833(2007) The finished DNA sequence of human chromosome 12.Baylor College of Medicine Human Genome Sequencing Center Sequence Production TeamScherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.Nature 440:346-351(2006) Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C. Identification of a survival-promoting peptide in medium conditioned by oxidatively stressed cell lines of nervous system origin.Cunningham T.J., Hodge L., Speicher D., Reim D., Tyler-Polsz C., Levitt P., Eagleson K., Kennedy S., Wang Y.J. Neurosci. 18:7047-7060(1998) Signal peptide prediction based on analysis of experimentally verified cleavage sites.Zhang Z., Henzel W.J.Protein Sci. 13:2819-2824(2004) Lysine acetylation targets protein complexes and co-regulates major cellular functions.Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M.Science 325:834-840(2009) Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011) An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014) Analysis of the solution structure of the human antibiotic peptide dermcidin and its interaction with phospholipid vesicles.Jung H.H., Yang S.T., Sim J.Y., Lee S., Lee J.Y., Kim H.H., Shin S.Y., Kim J.I.BMB Rep. 43:362-368(2010)

NCBI and Uniprot Product Information

• NCBI GI #: 665505971
• NCBI GeneID: 117159
• NCBI Accession #: NP_001287783.1
• NCBI GenBank Nucleotide #: NM_001300854.1
• UniProt Accession #: P81605; P58461; Q53YJ2; A5JHP2; A5JHP3
• Molecular Weight: 11.3 kDa
• NCBI Official Full Name: dermcidin isoform 2 preproprotein
• NCBI Official Synonym Full Names: dermcidin
• NCBI Official Symbol: DCD
• NCBI Official Synonym Symbols: PIF; AIDD; DSEP; HCAP; DCD-1
• NCBI Protein Information: dermcidin
• UniProt Protein Name: Dermcidin
• UniProt Gene Name: DCD
• UniProt Synonym Gene Names: AIDD; DSEP
• UniProt Entry Name: DCD_HUMAN