Diphosphoinositol polyphosphate phosphohydrolase DDP1 Recombinant Protein | DDP1 recombinant protein
Recombinant Saccharomyces cerevisiae (strain 204508 / S288c) (Baker's yeast) Diphosphoinositol polyphosphate phosphohydrolase DDP1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Diphosphoinositol polyphosphate phosphohydrolase DDP1; N/A; Recombinant Saccharomyces cerevisiae (strain 204508 / S288c) (Baker's yeast) Diphosphoinositol polyphosphate phosphohydrolase DDP1; Diadenosine 5',5'''-P1,P6-hexaphosphate hydrolase; Ap6A hydrolase; Diadenosine and diphosphoinositol polyphosphate phosphohydrolase 1; Diadenosine hexaphosphate hydrolase (AMP-forming); DDP1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-188aa; Full Length
Sequence
GKTADNHGPVRSETAREGRENQVYSPVTGARLVAGCICLTPDKKQVLMITSSAHKKRWIVPKGGVEKDEPNYETTAQRETWEEAGCIGKIVANLGTVEDMRPPKDWNKDIKQFENSRKDSEVAKHPPRTEFHFYELEIENLLDKFPECHKRHRKLYSYTEAKQNLIDAKRPELLEALNRSAIIKDDK
Sequence Length
188
Species
Saccharomyces cerevisiae (strain # 204508 / S288c) (Baker's yeast)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for DDP1 recombinant protein
May eliminate potentially toxic dinucleoside polyphosphates during sporulation. Most active against diadenosine 5',5'''-P1,P6-hexaphosphate (Ap6A). Can also hydrolyze diadenosine 5',5'''-P1,P5-pentaphosphate (Ap5A), adenosine 5'-pentaphosphate, and adenosine 5'-tetraphosphate are also substrates, but not diadenosine 5',5'''-P1,P4-tetraphosphate (Ap4A) or other dinucleotides, mononucleotides, nucleotide sugars, or nucleotide alcohols. Also cleaves a beta-phosphate from the diphosphate groups in PP-InsP5 (diphosphoinositol pentakisphosphate) and [PP]2-InsP4 (bisdiphosphoinositol tetrakisphosphate)
References
"The diadenosine hexaphosphate hydrolases from Schizosaccharomyces pombe and Saccharomyces cerevisiae are homologues of the human diphosphoinositol polyphosphate phosphohydrolase. Overlapping substrate specificities in a MutT-type protein." Safrany S.T., Ingram S.W., Cartwright J.L., Falck J.R., McLennan A.G., Barnes L.D., Shears S.B. J. Biol. Chem. 274:21735-21740(1999)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
37.4 kDa
NCBI Official Full Name
polyphosphatase DDP1
NCBI Official Symbol
DDP1
NCBI Protein Information
polyphosphatase DDP1
UniProt Protein Name
Diphosphoinositol polyphosphate phosphohydrolase DDP1
UniProt Gene Name
DDP1
UniProt Synonym Gene Names
Ap6A hydrolase
UniProt Entry Name
DDP1_YEAST
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The DDP1 ddp1 (Catalog #AAA116513) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-188aa; Full Length. The amino acid sequence is listed below: GKTADNHGPV RSETAREGRE NQVYSPVTGA RLVAGCICLT PDKKQVLMIT SSAHKKRWIV PKGGVEKDEP NYETTAQRET WEEAGCIGKI VANLGTVEDM RPPKDWNKDI KQFENSRKDS EVAKHPPRTE FHFYELEIEN LLDKFPECHK RHRKLYSYTE AKQNLIDAKR PELLEALNRS AIIKDDK. It is sometimes possible for the material contained within the vial of "Diphosphoinositol polyphosphate phosphohydrolase DDP1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
