Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

ATP-dependent RNA helicase DDX19A Recombinant Protein | DD19A recombinant protein

Recombinant Human ATP-dependent RNA helicase DDX19A

Gene Names
DDX19A; DDX19L; DDX19-DDX19L
Reactivity
Human
Purity
Greater than 90% as determined by SDS-PAGE.
Synonyms
ATP-dependent RNA helicase DDX19A; N/A; Recombinant Human ATP-dependent RNA helicase DDX19A; DDX19-like proteinDEAD box protein 19A; DD19A recombinant protein
Ordering
Host
E Coli
Reactivity
Human
Purity/Purification
Greater than 90% as determined by SDS-PAGE.
Form/Format
Tris-based buffer50% glycerol
Sequence Positions
Full Length, 1-478
Sequence
MATDSWALAVDEQEAAVKSMTNLQIKEEKVKADTNGIIKTSTTAEKTDEEEKEDRAAQSLLNKLIRSNLVDNTNQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPMMLAEPPQNLIAQSQSGTGKTAAFVLAMLSRVEPSDRYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVIKLKREEETLDTIKQYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMMVEQRAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTGRFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLDTDDLDEIEKIAN
Tag
N-terminal 6xHis-SUMO-tagged
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C,-80°C. The shelf life of lyophilized form is 12 months at -20°C,-80°C.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Related Product Information for DD19A recombinant protein
ATP-dependent RNA helicase involved in mRNA export from the nucleus. Rather than unwinding RNA duplexes, DDX19 functions as a rodeler of ribonucleoprotein particles, whereby proteins bound to nuclear mRNA are dissociated and replaced by cytoplasmic mRNA binding proteins.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
70 kDa
NCBI Official Full Name
ATP-dependent RNA helicase DDX19A isoform 2
NCBI Official Synonym Full Names
DEAD-box helicase 19A
NCBI Official Symbol
DDX19A
NCBI Official Synonym Symbols
DDX19L; DDX19-DDX19L
NCBI Protein Information
ATP-dependent RNA helicase DDX19A
UniProt Protein Name
ATP-dependent RNA helicase DDX19A
UniProt Gene Name
DDX19A
UniProt Synonym Gene Names
DDX19L

Similar Products

Product Notes

The DD19A ddx19a (Catalog #AAA309761) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is Full Length, 1-478. The Recombinant Human ATP-dependent RNA helicase DDX19A reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: MATDSWALAV DEQEAAVKSM TNLQIKEEKV KADTNGIIKT STTAEKTDEE EKEDRAAQSL LNKLIRSNLV DNTNQVEVLQ RDPNSPLYSV KSFEELRLKP QLLQGVYAMG FNRPSKIQEN ALPMMLAEPP QNLIAQSQSG TGKTAAFVLA MLSRVEPSDR YPQCLCLSPT YELALQTGKV IEQMGKFYPE LKLAYAVRGN KLERGQKISE QIVIGTPGTV LDWCSKLKFI DPKKIKVFVL DEADVMIATQ GHQDQSIRIQ RMLPRNCQML LFSATFEDSV WKFAQKVVPD PNVIKLKREE ETLDTIKQYY VLCSSRDEKF QALCNLYGAI TIAQAMIFCH TRKTASWLAA ELSKEGHQVA LLSGEMMVEQ RAAVIERFRE GKEKVLVTTN VCARGIDVEQ VSVVINFDLP VDKDGNPDNE TYLHRIGRTG RFGKRGLAVN MVDSKHSMNI LNRIQEHFNK KIERLDTDDL DEIEKIAN. It is sometimes possible for the material contained within the vial of "ATP-dependent RNA helicase DDX19A, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.