Peptide deformylase Recombinant Protein | def recombinant protein
Recombinant Escherichia coli Peptide deformylase
Purity
Greater than 90% as determined by SDS-PAGE
Synonyms
Peptide deformylase; N/A; Recombinant Escherichia coli Peptide deformylase; Polypeptide deformylase; def recombinant protein
Host
E.coli
Purity/Purification
Greater than 90% as determined by SDS-PAGE
Form/Format
Tris-based buffer50% glycerol
Sequence
SVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLSPLKQQRIRQKVEKLDRLKARA
Immunonogen Description
Expression Region:2-169aaSequence Info:Full Length
Calculated MW
35.2 kDa
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stabilityof the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C,-80°C. The shelf life of lyophilized form is 12 months at -20°C,-80°C.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Generally, the shelf life of liquid form is 6 months at -20°C,-80°C. The shelf life of lyophilized form is 12 months at -20°C,-80°C.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Related Product Information for def recombinant protein
Recombinant Escherichia coli Peptide deformylase(def)
Roves the formyl group from the N-terminal Met of newly synthesized proteins. Requires at least a dipeptide for an efficient rate of reaction. N-terminalL-methionine is a prerequisite for activity but the enzyme has broad specificity at other position.
Roves the formyl group from the N-terminal Met of newly synthesized proteins. Requires at least a dipeptide for an efficient rate of reaction. N-terminalL-methionine is a prerequisite for activity but the enzyme has broad specificity at other position.
NCBI and Uniprot Product Information
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The Peptide deformylase def (Catalog #AAA309738) is a Recombinant Protein produced from E.coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: SVLQVLHIPD ERLRKVAKPV EEVNAEIQRI VDDMFETMYA EEGIGLAATQ VDIHQRIIVI DVSENRDERL VLINPELLEK SGETGIEEGC LSIPEQRALV PRAEKVKIRA LDRDGKPFEL EADGLLAICI QHEMDHLVGK LFMDYLSPLK QQRIRQKVEK LDRLKARA. It is sometimes possible for the material contained within the vial of "Peptide deformylase, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.