Periplasmic serine endoprotease DegP Recombinant Protein | degP recombinant protein
Recombinant Escherichia coli Periplasmic serine endoprotease DegP
Gene Names
degP; ECK0160; htrA; JW0157; ptd
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Periplasmic serine endoprotease DegP; N/A; Recombinant Escherichia coli Periplasmic serine endoprotease DegP; Heat shock protein DegP; Protease Do; degP recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
27-474aa; Full Length of Mature Protein
Sequence
AETSSATTAQQMPSLAPMLEKVMPSVVSINVEGSTTVNTPRMPRNFQQFFGDDSPFCQEGSPFQSSPFCQGGQGGNGGGQQQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIKMADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYENFIQTDAAINRGNSGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLELQQSSQNQVDSSSIFNGIEGAEMSNKGKDQGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAELRKVLDSKPSVLALNIQRGDSTIYLLMQ
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for degP recombinant protein
DegP acts as a chaperone at low temperatures but switches to a peptidase (heat shock protein) at higher temperatures. It degrades transiently denatured and unfolded proteins which accumulate in the periplasm following heat shock or other stress conditions. DegP is efficient with Val-Xaa and Ile-Xaa peptide bonds, suggesting a preference for beta-branched side chain amino acids. Only unfolded proteins devoid of disulfide bonds appear capable of being cleaved, thereby preventing non-specific proteolysis of folded proteins. Its proteolytic activity is essential for the survival of cells at elevated temperatures. It can degrade IciA, ada, casein, globin and PapA. DegP shares specificity with DegQ. DegP is also involved in the biogenesis of partially folded outer-membrane proteins (OMP).
References
Sequence analysis and regulation of the htrA gene of Escherichia coli a sigma 32-independent mechanism of heat-inducible transcription.Lipinska B., Sharma S., Georgopoulos C.Nucleic Acids Res. 16:10053-10067(1988) Systematic sequencing of the Escherichia coli genome analysis of the 2.4-4.1 min (110,917-193,643 bp) region.Fujita N., Mori H., Yura T., Ishihama A.Nucleic Acids Res. 22:1637-1639(1994) Sequence of minutes 4-25 of Escherichia coli.Chung E., Allen E., Araujo R., Aparicio A.M., Davis K., Duncan M., Federspiel N., Hyman R., Kalman S., Komp C., Kurdi O., Lew H., Lin D., Namath A., Oefner P., Roberts D., Schramm S., Davis R.W. The complete genome sequence of Escherichia coli K-12.Blattner F.R., Plunkett G. III, Bloch C.A., Perna N.T., Burland V., Riley M., Collado-Vides J., Glasner J.D., Rode C.K., Mayhew G.F., Gregor J., Davis N.W., Kirkpatrick H.A., Goeden M.A., Rose D.J., Mau B., Shao Y.Science 277:1453-1462(1997) Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110.Hayashi K., Morooka N., Yamamoto Y., Fujita K., Isono K., Choi S., Ohtsubo E., Baba T., Wanner B.L., Mori H., Horiuchi T.Mol. Syst. Biol. 2:E1-E5(2006) Primary structure of the deoxyguanosine triphosphate triphosphohydrolase-encoding gene (dgt) of Escherichia coli.Quirk S., Bhatnagar S.K., Bessman M.J.Gene 89:13-18(1990) Structure and regulation of the gene for dGTP triphosphohydrolase from Escherichia coli.Wurgler S.M., Richardson C.C.Proc. Natl. Acad. Sci. U.S.A. 87:2740-2744(1990) The HtrA (DegP) protein, essential for Escherichia coli survival at high temperatures, is an endopeptidase.Lipinska B., Zylicz M., Georgopoulos C.J. Bacteriol. 172:1791-1797(1990) Protein identification with N and C-terminal sequence tags in proteome projects.Wilkins M.R., Gasteiger E., Tonella L., Ou K., Tyler M., Sanchez J.-C., Gooley A.A., Walsh B.J., Bairoch A., Appel R.D., Williams K.L., Hochstrasser D.F.J. Mol. Biol. 278:599-608(1998) Protease Do is essential for survival of Escherichia coli at high temperatures its identity with the htrA gene product.Seol J.H., Woo S.K., Jung E.M., Yoo S.J., Lee C.S., Kim K.J., Tanaka K., Ichihara A., Ha D.B., Chung C.H.Biochem. Biophys. Res. Commun. 176:730-736(1991) Site-directed mutagenesis of the HtrA (DegP) serine protease, whose proteolytic activity is indispensable for Escherichia coli survival at elevated temperatures (above 42 degrees Celsius) .Skorko-Glonek J., Wawrzynow A., Krzewski K., Kurpierz K., Lipinska B.Gene 163:47-52(1995) The Cpx two-component signal transduction pathway of Escherichia coli regulates transcription of the gene specifying the stress-inducible periplasmic protease, DegP.Danese P.N., Snyder W.B., Cosma C.L., Davis L.J., Silhavy T.J.Genes Dev. 9:387-398(1995) Comparison of the structure of wild-type HtrA heat shock protease and mutant HtrA proteins. A Fourier transform infrared spectroscopic study.Skorko-Glonek J., Krzewski K., Lipinska B., Bertoli E., Tanfani F.J. Biol. Chem. 270:11140-11146(1995) The DegP and DegQ periplasmic endoproteases of Escherichia coli specificity for cleavage sites and substrate conformation.Kolmar H., Waller P.R., Sauer R.T.J. Bacteriol. 178:5925-5929(1996) HtrA heat shock protease interacts with phospholipid membranes and undergoes conformational changes.Skorko-Glonek J., Lipinska B., Krzewski K., Zolese G., Bertoli E., Tanfani F.J. Biol. Chem. 272:8974-8982(1997) A temperature-dependent switch from chaperone to protease in a widely conserved heat shock protein.Spiess C., Beil A., Ehrmann M.Cell 97:339-347(1999) Escherichia coli DegP protease cleaves between paired hydrophobic residues in a natural substrate the PapA pilin.Jones C.H., Dexter P., Evans A.K., Liu C., Hultgren S.J., Hruby D.E.J. Bacteriol. 184:5762-5771(2002) The N-terminal region of HtrA heat shock protease from Escherichia coli is essential for stabilization of HtrA primary structure and maintaining of its oligomeric structure.Skorko-Glonek J., Zurawa D., Tanfani F., Scire A., Wawrzynow A., Narkiewicz J., Bertoli E., Lipinska B.Biochim. Biophys. Acta 1649:171-182(2003) Interplay of PDZ and protease domain of DegP ensures efficient elimination of misfolded proteins.Krojer T., Pangerl K., Kurt J., Sawa J., Stingl C., Mechtler K., Huber R., Ehrmann M., Clausen T.Proc. Natl. Acad. Sci. U.S.A. 105:7702-7707(2008) Activation of DegP chaperone-protease via formation of large cage-like oligomers upon binding to substrate proteins.Jiang J., Zhang X., Chen Y., Wu Y., Zhou Z.H., Chang Z., Sui S.F.Proc. Natl. Acad. Sci. U.S.A. 105:11939-11944(2008) The role of the L2 loop in the regulation and maintaining the proteolytic activity of HtrA (DegP) protein from Escherichia coli.Sobiecka-Szkatula A., Gieldon A., Scire A., Tanfani F., Figaj D., Koper T., Ciarkowski J., Lipinska B., Skorko-Glonek J.Arch. Biochem. Biophys. 500:123-130(2010) Factors defining the functional oligomeric state of Escherichia coli DegP protease.Iwanczyk J., Leong V., Ortega J.PLoS ONE 6:E18944-E18944(2011) Crystal structure of DegP (HtrA) reveals a new protease-chaperone machine.Krojer T., Garrido-Franco M., Huber R., Ehrmann M., Clausen T.Nature 416:455-459(2002) Roles of DegP in prevention of protein misfolding in the periplasm upon overexpression of penicillin acylase in Escherichia coli.Pan K.L., Hsiao H.C., Weng C.L., Wu M.S., Chou C.P.J. Bacteriol. 185:3020-3030(2003) Structural basis for the regulated protease and chaperone function of DegP.Krojer T., Sawa J., Schafer E., Saibil H.R., Ehrmann M., Clausen T.Nature 453:885-890(2008) HtrA proteases have a conserved activation mechanism that can be triggered by distinct molecular cues.Krojer T., Sawa J., Huber R., Clausen T.Nat. Struct. Mol. Biol. 17:844-852(2010) Covalent linkage of distinct substrate degrons controls assembly and disassembly of DegP proteolytic cages.Kim S., Grant R.A., Sauer R.T.Cell 145:67-78(2011)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
48.8 kDa
NCBI Official Full Name
serine endoprotease (protease Do), membrane-associated
NCBI Official Symbol
degP
NCBI Official Synonym Symbols
ECK0160; htrA; JW0157; ptd
NCBI Protein Information
serine endoprotease (protease Do), membrane-associated
UniProt Protein Name
Periplasmic serine endoprotease DegP
UniProt Gene Name
degP
UniProt Synonym Gene Names
htrA; ptd
UniProt Entry Name
DEGP_ECOLI
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The degP degp (Catalog #AAA115692) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 27-474aa; Full Length of Mature Protein. The amino acid sequence is listed below: AETSSATTAQ QMPSLAPMLE KVMPSVVSIN VEGSTTVNTP RMPRNFQQFF GDDSPFCQEG SPFQSSPFCQ GGQGGNGGGQ QQKFMALGSG VIIDADKGYV VTNNHVVDNA TVIKVQLSDG RKFDAKMVGK DPRSDIALIQ IQNPKNLTAI KMADSDALRV GDYTVAIGNP FGLGETVTSG IVSALGRSGL NAENYENFIQ TDAAINRGNS GGALVNLNGE LIGINTAILA PDGGNIGIGF AIPSNMVKNL TSQMVEYGQV KRGELGIMGT ELNSELAKAM KVDAQRGAFV SQVLPNSSAA KAGIKAGDVI TSLNGKPISS FAALRAQVGT MPVGSKLTLG LLRDGKQVNV NLELQQSSQN QVDSSSIFNG IEGAEMSNKG KDQGVVVNNV KTGTPAAQIG LKKGDVIIGA NQQAVKNIAE LRKVLDSKPS VLALNIQRGD STIYLLMQ. It is sometimes possible for the material contained within the vial of "Periplasmic serine endoprotease DegP, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
