Deoxyribonuclease gamma (DNASE1L3) Recombinant Protein | DNASE1L3 recombinant protein

Recombinant Human Deoxyribonuclease gamma (DNASE1L3)

Cat. Num. AAA235627

• Gene Names: DNASE1L3; LSD; DHP2; SLEB16; DNAS1L3
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Deoxyribonuclease gamma (DNASE1L3); N/A; Recombinant Human Deoxyribonuclease gamma (DNASE1L3); DNase I homolog protein DHP2; Deoxyribonuclease I-like 3; DNase I-like 3; Liver and spleen DNase; LS-DNase; LSD; DNase gamma; DHP2; DNAS1L3; DNASE1L3 recombinant protein

• Host: E Coli
• Specificity: Liver and spleen.
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 21-305aa; Full Length of Mature Protein
• Sequence: MRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS

• Species: Human
• Tag: Tag-Free
• Subcellular Location: Nucleus, Endoplasmic Reticulum, Secreted
• Protein Families: DNase I family
• Preparation and Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.; Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for DNASE1L3 recombinant protein

Has DNA hydrolytic activity. Is capable of both single- and double-stranded DNA cleavage, producing DNA fragments with 3'-OH ends. Can cleave chromatin to nucleosomal units and cleaves nucleosomal and liposome-coated DNA. Acts in internucleosomal DNA fragmentation during apoptosis and necrosis. The role in apoptosis includes myogenic and neuronal differentiation, and BCR-mediated clonal deletion of self-reactive B cells. Is active on chromatin in apoptotic cell-derived membrane-coated microparticles and thus suppresses anti-DNA autoimmunity. Together with DNASE1, plays a key role in degrading neutrophil extracellular traps. NETs are mainly composed of DNA fibers and are released by neutrophils to bind pathogens during inflammation. Degradation of intravascular NETs by DNASE1 and DNASE1L3 is required to prevent formation of clots that obstruct blood vessels and cause organ damage following inflammation.

References

"cDNA cloning of human DNase gamma: chromosomal localization of its gene and enzymatic properties of recombinant protein." Shiokawa D., Hirai M., Tanuma S. Apoptosis 3:89-95(1998).

NCBI and Uniprot Product Information

• NCBI GI #: 2494173
• NCBI GeneID: 1776
• UniProt Accession #: Q13609
• Molecular Weight: 33.4 kDa
• NCBI Official Full Name: Deoxyribonuclease gamma
• NCBI Official Synonym Full Names: deoxyribonuclease 1 like 3
• NCBI Official Symbol: DNASE1L3
• NCBI Official Synonym Symbols: LSD; DHP2; SLEB16; DNAS1L3
• NCBI Protein Information: deoxyribonuclease gamma
• UniProt Protein Name: Deoxyribonuclease gamma
• UniProt Gene Name: DNASE1L3
• UniProt Synonym Gene Names: DHP2; DNAS1L3; DNase gamma; DNase I-like 3; LS-DNase; LSD
• UniProt Entry Name: DNSL3_HUMAN