Dynamin-1 Recombinant Protein | DNM1 recombinant protein

Recombinant Human Dynamin-1

Cat. Num. AAA114139

• Gene Names: DNM1; DNM; EIEE31
• Purity: Greater than 90% as determined by SDS-PAGE.
• Synonyms: Dynamin-1; N/A; Recombinant Human Dynamin-1; DNM1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater than 90% as determined by SDS-PAGE.
• Form/Format: Liquid or Lyophilized powder; If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8
• Sequence Positions: 2-245aa; Partial
• Sequence: GNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGK

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for DNM1 recombinant protein

Microtubule-associated force-producing protein involved in producing microtubule bundles and able to bind and hydrolyze GTP. Most probably involved in vesicular trafficking processes. Involved in receptor-mediated endocytosis.

Product Categories/Family for DNM1 recombinant protein

Neuroscience

References

Mutations in human dynamin block an intermediate stage in coated vesicle formation.van der Bliek A.M., Redelmeier T.E., Tisdale E.J., Meyerowitz E.M., Schmid S.L.J. Cell Biol. 122:553-563(1993) DNA sequence and analysis of human chromosome 9.Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.Nature 429:369-374(2004) SNX9 regulates dynamin assembly and is required for efficient clathrin-mediated endocytosis.Soulet F., Yarar D., Leonard M., Schmid S.L.Mol. Biol. Cell 16:2058-2067(2005) Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.Cell 127:635-648(2006) Myosin 1E interacts with synaptojanin-1 and dynamin and is involved in endocytosis.Krendel M., Osterweil E.K., Mooseker M.S.FEBS Lett. 581:644-650(2007) A novel sorting nexin modulates endocytic trafficking and alpha-secretase cleavage of the amyloid precursor protein.Schobel S., Neumann S., Hertweck M., Dislich B., Kuhn P.H., Kremmer E., Seed B., Baumeister R., Haass C., Lichtenthaler S.F.J. Biol. Chem. 283:14257-14268(2008) Phosphoproteome of resting human platelets.Zahedi R.P., Lewandrowski U., Wiesner J., Wortelkamp S., Moebius J., Schuetz C., Walter U., Gambaryan S., Sickmann A.J. Proteome Res. 7:526-534(2008) Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011) Three-dimensional solution structure of the pleckstrin homology domain from dynamin.Downing A.K., Driscoll P.C., Gout I., Salim K., Zvelebil M.J., Waterfield M.D.Curr. Biol. 4:884-891(1994) Crystal structure at 2.2-A resolution of the pleckstrin homology domain from human dynamin.Ferguson K.M., Lemmon M.A., Schlessinger J., Sigler P.B.Cell 79:199-209(1994) Crystal structure of the pleckstrin homology domain from dynamin.Timm D., Salim K., Gout I., Guruprasad L., Waterfield M., Blundell T.Nat. Struct. Biol. 1:782-788(1994)

NCBI and Uniprot Product Information

• NCBI GI #: 56549117
• NCBI GeneID: 1759
• NCBI Accession #: NP_001005336.1
• NCBI GenBank Nucleotide #: NM_001005336.2
• UniProt Accession #: Q05193; Q5SYX0; Q5SYX2; Q6P3T6; Q86VD2; A6NLM6
• Molecular Weight: 28.7 kDa
• NCBI Official Full Name: dynamin-1 isoform 2
• NCBI Official Synonym Full Names: dynamin 1
• NCBI Official Symbol: DNM1
• NCBI Official Synonym Symbols: DNM; EIEE31
• NCBI Protein Information: dynamin-1
• UniProt Protein Name: Dynamin-1
• UniProt Gene Name: DNM1
• UniProt Synonym Gene Names: DNM
• UniProt Entry Name: DYN1_HUMAN