Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA253922_AD11.png Application Data (Active alpha synuclein aggregate seeds the formation of new alpha Synuclein aggregates from the pool of active alpha Synuclein monomers. Thioflavin T is a fluorescent dye that binds to beta sheet-rich structures, such as those in alpha Synuclein aggregates. Upon binding, the emission spectrum of the dye experiences a red-shift, and increased fluorescence intensity. Thioflavin T emission curves show increased fluorescence (correlated to alpha Synuclein protein aggregation) over time when 10 nM of active alpha Synuclein aggregate is combined with 100 uM of active alpha Synuclein monomer, as compared to when 100 uM of active alpha Synuclein monomer is combined with 10 nM of control alpha Synuclein aggregate, or 100 uM of control alpha Synuclein monomer is combined with 10 nM of control alpha Synuclein aggregate. Thioflavin T ex = 450 nm, em = 485 nm.)

Alpha Synuclein Active Protein | SNCA active protein

Alpha Synuclein Protein

Average rating 0.0
No ratings yet
Gene Names
SNCA; PD1; NACP; PARK1; PARK4
Applications
SDS-Page, Western Blot
Purity
Ion-exchange Purified
Synonyms
Alpha Synuclein; N/A; Alpha Synuclein Protein; Human Recombinant Alpha Synuclein Protein Aggregates Pre-formed Fibrils; Alpha synuclein pre-formed fibrils; Alpha synuclein aggregates; Alpha synuclein protein aggregates; Alpha-synuclein protein; Non-A beta component of AD amyloid protein; Non-A4 component of amyloid precursor protein; NACP protein; SNCA protein; PARK1 protein; SYN protein; Parkison disease familial 1 Protein; SNCA active protein
Ordering
Host
E Coli
Specificity
~14.46 kDa
Purity/Purification
Ion-exchange Purified
Sequence
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Sequence Length
Full Length
Applicable Applications for SNCA active protein
Invitro Assay, SDS-PAGE, WB (Western Blot)
Species
Human
Target
Alpha Synuclein
Cellular Localization
Cytoplasm; Membrane; Nucleus
Storage Buffer
0.2um filtered solution in 20mM tris, 150mM NaCl pH7.5
Endotoxin Level
Endotoxin below 1EU/ug as determined by LAL assay.
Tag Information
No tag
Preparation and Storage
Store at -80 degree C.

Application Data

(Active alpha synuclein aggregate seeds the formation of new alpha Synuclein aggregates from the pool of active alpha Synuclein monomers. Thioflavin T is a fluorescent dye that binds to beta sheet-rich structures, such as those in alpha Synuclein aggregates. Upon binding, the emission spectrum of the dye experiences a red-shift, and increased fluorescence intensity. Thioflavin T emission curves show increased fluorescence (correlated to alpha Synuclein protein aggregation) over time when 10 nM of active alpha Synuclein aggregate is combined with 100 uM of active alpha Synuclein monomer, as compared to when 100 uM of active alpha Synuclein monomer is combined with 10 nM of control alpha Synuclein aggregate, or 100 uM of control alpha Synuclein monomer is combined with 10 nM of control alpha Synuclein aggregate. Thioflavin T ex = 450 nm, em = 485 nm.)

product-image-AAA253922_AD11.png Application Data (Active alpha synuclein aggregate seeds the formation of new alpha Synuclein aggregates from the pool of active alpha Synuclein monomers. Thioflavin T is a fluorescent dye that binds to beta sheet-rich structures, such as those in alpha Synuclein aggregates. Upon binding, the emission spectrum of the dye experiences a red-shift, and increased fluorescence intensity. Thioflavin T emission curves show increased fluorescence (correlated to alpha Synuclein protein aggregation) over time when 10 nM of active alpha Synuclein aggregate is combined with 100 uM of active alpha Synuclein monomer, as compared to when 100 uM of active alpha Synuclein monomer is combined with 10 nM of control alpha Synuclein aggregate, or 100 uM of control alpha Synuclein monomer is combined with 10 nM of control alpha Synuclein aggregate. Thioflavin T ex = 450 nm, em = 485 nm.)

Application Data

(Primary rat hippocampal neurons show lewy body inclusion formation when treated with active Alpha Synuclein Protein Aggregate at 4 ug/ml (D-F), but not when treated with control Alpha Synuclein Protein Aggregate at 4 ug/ml (A-C). Tissue: Primary hippocampal neurons. Species: Sprague-Dawley rat. Fixation: 4% formaldehyde made from PFA. Primary Antibody: Mouse anti-pSer129 Antibody at 1:1000 24 hours at 4 degree C. Secondary Antibody: FITC Goat Anti-Mouse (green) at 1:700 for 1 hours at RT. Counterstain: Hoechst (blue) nuclear stain at 1:4000 for 1 hour at RT. Localization: Lewy body incluscions. Magnification: 20x.)

product-image-AAA253922_AD13.png Application Data (Primary rat hippocampal neurons show lewy body inclusion formation when treated with active Alpha Synuclein Protein Aggregate at 4 ug/ml (D-F), but not when treated with control Alpha Synuclein Protein Aggregate at 4 ug/ml (A-C). Tissue: Primary hippocampal neurons. Species: Sprague-Dawley rat. Fixation: 4% formaldehyde made from PFA. Primary Antibody: Mouse anti-pSer129 Antibody at 1:1000 24 hours at 4 degree C. Secondary Antibody: FITC Goat Anti-Mouse (green) at 1:700 for 1 hours at RT. Counterstain: Hoechst (blue) nuclear stain at 1:4000 for 1 hour at RT. Localization: Lewy body incluscions. Magnification: 20x.)

SDS-PAGE

(SDS-PAGE of ~14 kDa Human Recombinant Alpha Synuclein Protein Aggregate. Lane 1: Molecular Weight Ladder (MW). Lane 2: Alpha Synuclein Protein Aggregate (SPR-317).)

product-image-AAA253922_SDS_PAGE15.png SDS-PAGE (SDS-PAGE of ~14 kDa Human Recombinant Alpha Synuclein Protein Aggregate. Lane 1: Molecular Weight Ladder (MW). Lane 2: Alpha Synuclein Protein Aggregate (SPR-317).)
Related Product Information for SNCA active protein
Alpha-Synuclein (SNCA) is expressed predominantly in the brain, where it is concentrated in presynaptic nerve terminals (1). Alpha-synuclein is highly expressed in the mitochondria of the olfactory bulb, hippocampus, striatum and thalamus (2). Functionally, it has been shown to significantly interact with tubulin (3), and may serve as a potential microtubule-associated protein. It has also been found to be essential for normal development of the cognitive functions; inactivation may lead to impaired spatial learning and working memory (4).
SNCA fibrillar aggregates represent the major non A-beta component of Alzheimers disease amyloid plaque, and a major component of Lewy body inclusions, and Parkinson's disease. Parkinson's disease (PD) is a common neurodegenerative disorder characterized by the progressive accumulation in selected neurons of protein inclusions containing alpha-synuclein and ubiquitin (5, 6).
References
1. "Genetics Home Reference: SNCA". US National Library of Medicine. (2013). 2. Zhang L., et al. (2008) Brain Res. 1244: 40-52. 3. Alim M.A., et al. (2002) J Biol Chem. 277(3): 2112-2117. 4. Kokhan V.S., Afanasyeva M.A., Van'kin G. (2012) Behav. Brain. Res. 231(1): 226-230. 5. Spillantini M.G., et al. (1997) Nature. 388(6645): 839-840. 6. Mezey E., et al. (1998) Nat Med. 4(7): 755-757.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
13,109 Da
NCBI Official Full Name
alpha-synuclein isoform NACP140
NCBI Official Synonym Full Names
synuclein alpha
NCBI Official Symbol
SNCA
NCBI Official Synonym Symbols
PD1; NACP; PARK1; PARK4
NCBI Protein Information
alpha-synuclein
UniProt Protein Name
Alpha-synuclein
UniProt Gene Name
SNCA
UniProt Synonym Gene Names
NACP; PARK1; NACP

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The SNCA snca (Catalog #AAA253922) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The tag for this protein is No tag. AAA Biotech's Alpha Synuclein can be used in a range of immunoassay formats including, but not limited to, Invitro Assay, SDS-PAGE, WB (Western Blot). Researchers should empirically determine the suitability of the SNCA snca for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MDVFMKGLSK AKEGVVAAAE KTKQGVAEAA GKTKEGVLYV GSKTKEGVVH GVATVAEKTK EQVTNVGGAV VTGVTAVAQK TVEGAGSIAA ATGFVKKDQL GKNEEGAPQE GILEDMPVDP DNEAYEMPSE EGYQDYEPEA. It is sometimes possible for the material contained within the vial of "Alpha Synuclein, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.