Beta-Nerve Growth Factor (NGF) Active Protein | NGF active protein
Recombinant Human Beta-nerve growth factor (NGF) (Active)
Gene Names
NGF; NGFB; HSAN5; Beta-NGF
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Beta-Nerve Growth Factor (NGF); N/A; Recombinant Human Beta-nerve growth factor (NGF) (Active); Beta-Nerve Growth Factor; Beta-NGF; NGF; NGFB; NGF active protein
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 mum Filtered 20 mM PB, 250 mM NaCl, pH 7.0
Sequence Positions
122-241aa; Full Length of Mature Protein
Sequence
SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA
Species
Human
Tag
Tag-Free
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined in a cell proliferation assay using TF-1 human erythroleukemic cells is less than 2 ng/ml.
Subcellular Location
Secreted
Protein Families
NGF-beta Family
Classification
Cytokine
Subdivision
Growth Factor
Pathway
MAPK Signaling Pathway
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for NGF active protein
Relevance: Human beta-Nerve Growth Factor (beta-NGF) was initially isolated in the mouse submandibular gland. It is composed of three non-covalently linked subunits alpha, beta, and gamma; it exhibits all the biological activities ascribed to NGF. It is structurally related to BDNF, NT-3 and NT-4 and belongs to the cysteine-knot family of growth factors that assume stable dimeric structures. beta-NGF is a neurotrophic factor that signals through its receptor beta-NGF, and plays a crucial role in the development and preservation of the sensory and sympathetic nervous systems. beta-NGF also acts as a growth and differentiation factor for B lymphocytes and enhances B-cell survival. These results suggest that beta-NGF is a pleiotropic cytokine, which in addition to its neurotropic activities may have an important role in the regulation of the immune system. Human beta-NGF shares 90% sequence similarity with mouse protein and shows cross-species reactivity.
Function: Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. Extracellular ligand for the NTRK1 and NGFR receptors, activates cellular signaling cascades through those receptor tyrosine kinase to regulate neuronal proliferation, differentiation and survival. Inhibits metalloproteinase dependent proteolysis of platelet glycoprotein VI.
Function: Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. Extracellular ligand for the NTRK1 and NGFR receptors, activates cellular signaling cascades through those receptor tyrosine kinase to regulate neuronal proliferation, differentiation and survival. Inhibits metalloproteinase dependent proteolysis of platelet glycoprotein VI.
Product Categories/Family for NGF active protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
13.4 kDa
NCBI Official Full Name
Beta-nerve growth factor
NCBI Official Synonym Full Names
nerve growth factor
NCBI Official Symbol
NGF
NCBI Official Synonym Symbols
NGFB; HSAN5; Beta-NGF
NCBI Protein Information
beta-nerve growth factor
UniProt Protein Name
Beta-nerve growth factor
UniProt Gene Name
NGF
UniProt Synonym Gene Names
NGFB; Beta-NGF
UniProt Entry Name
NGF_HUMAN
Similar Products
Product Notes
The NGF ngf (Catalog #AAA235613) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 122-241aa; Full Length of Mature Protein. The amino acid sequence is listed below: SSSHPIFHRG EFSVCDSVSV WVGDKTTATD IKGKEVMVLG EVNINNSVFK QYFFETKCRD PNPVDSGCRG IDSKHWNSYC TTTHTFVKAL TMDGKQAAWR FIRIDTACVC VLSRKAVRRA. It is sometimes possible for the material contained within the vial of "Beta-Nerve Growth Factor (NGF), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.