Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA114235_SDS_PAGE15.png SDS-PAGE

C-C motif chemokine 19 protein (Ccl19) Active Protein | Ccl19 active protein

Recombinant Mouse C-C motif chemokine 19 protein (Ccl19) (Active)

Gene Names
Ccl19; ELC; CKb11; MIP3B; Scya19; exodus-3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
C-C motif chemokine 19 protein (Ccl19); N/A; Recombinant Mouse C-C motif chemokine 19 protein (Ccl19) (Active); Epstein-Barr virus-induced molecule 1 ligand chemokine; ELC; Small-inducible cytokine A19; Ccl19 active protein
Ordering
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized
Sequence Positions
26-108aa; Full Length of Mature Protein
Sequence
GANDAEDCCLSVTQRPIPGNIVKAFRYLLNEDGCRVPAVVFTTLRGYQLCAPPDQPWVDRIIRRLKKSSAKNKGNSTRRSPVS
Species
Mus musculus (Mouse)
Biological Activity
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human mature dendritic cells is in a concentration range of 10-100 ng/ml.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Protein Note
Protein will be provided with aseptic processing and endotoxin removal.
Preparation and Storage
Generally, the shelf life of liquid form is 6 months at -20/-80 degree C. The shelf life of lyophilized form is 12 months at -20/-80 degree C.

SDS-PAGE

product-image-AAA114235_SDS_PAGE15.png SDS-PAGE
Related Product Information for Ccl19 active protein
Strongly chemotactic for naive (L-selectinhi) CD4 T-cells and for CD8 T-cells and weakly attractive for resting B-cells and memory (L-selectinlo) CD4 T-cells. May play a role in promoting encounters between recirculating T-cells and dendritic cells and in the migration of activated B-cells into the T-zone of secondary lymphoid tissues. Binds to chemokine receptor CCR7. Binds to atypical chemokine receptor ACKR4 and mediates the recruitment of beta-arrestin (ARRB1/2) to ACKR4.
Product Categories/Family for Ccl19 active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
9.2 kDa
NCBI Official Full Name
C-C motif chemokine 19
NCBI Official Synonym Full Names
chemokine (C-C motif) ligand 19
NCBI Official Symbol
Ccl19
NCBI Official Synonym Symbols
ELC; CKb11; MIP3B; Scya19; exodus-3
NCBI Protein Information
C-C motif chemokine 19
UniProt Protein Name
C-C motif chemokine 19
UniProt Gene Name
Ccl19
UniProt Synonym Gene Names
Elc; Scya19; EBI1 ligand chemokine; ELC

Similar Products

Product Notes

The Ccl19 ccl19 (Catalog #AAA114235) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 26-108aa; Full Length of Mature Protein. The amino acid sequence is listed below: GANDAEDCCL SVTQRPIPGN IVKAFRYLLN EDGCRVPAVV FTTLRGYQLC APPDQPWVDR IIRRLKKSSA KNKGNSTRRS PVS. It is sometimes possible for the material contained within the vial of "C-C motif chemokine 19 protein (Ccl19), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.