Carbonic Anhydrase 1 (CA1) Active Protein | CA1 active protein
Recombinant Human Carbonic Anhydrase 1 (CA1)
Gene Names
CA1; CAB; CA-I; Car1; HEL-S-11
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Carbonic Anhydrase 1 (CA1); N/A; Recombinant Human Carbonic Anhydrase 1 (CA1); Carbonic Anhydrase 1; Carbonate Dehydratase I; Carbonic Anhydrase B; CAB; Carbonic Anhydrase I; CA-I; CA1; CA1 active protein
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
0.2 mum Filtered 20 mM Tris-HCl, 150 mM NaCl, 10% Glycerol, pH 8.0
Sequence Positions
2-261aa; Full Length of Mature Protein
Sequence
ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
Species
Human
Tag
C-terminal 6xHis-tagged
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The esterase activity is determined to be greater than 500 pmol/min/ug
Subcellular Location
Cytoplasm
Protein Families
Alpha-Carbonic Anhydrase Family
Classification
Other Recombinant Protein
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for CA1 active protein
Relevance: Carbonic Anhydrase 1 (CA1) is a cytosolic enzyme, belonging to the alpha-carbonic anhydrase family. It is highly expressed in erythrocytes and acts as an early marker for erythroid differentiation. Carbonic anhydrase 1 plays a improtant role in many biological processes such as calcification, cellular respiration, bone resorption, acid-base balance. It is activated by imidazole, histamine, L-adrenaline, L- and D-histidine, and L- and D-phenylalanine. At the same time, It is inhibited by sulfonamide derivatives and coumarins. In addition, CA1 is a zinc metalloenzyme that has reversible hydration of carbon dioxide. It can hydrate cyanamide to urea.
Function: Reversible hydration of carbon dioxide. Can hydrates cyanamide to urea.
Function: Reversible hydration of carbon dioxide. Can hydrates cyanamide to urea.
Product Categories/Family for CA1 active protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29.93 kDa
NCBI Official Full Name
carbonic anhydrase 1 isoform a
NCBI Official Synonym Full Names
carbonic anhydrase 1
NCBI Official Symbol
CA1
NCBI Official Synonym Symbols
CAB; CA-I; Car1; HEL-S-11
NCBI Protein Information
carbonic anhydrase 1
UniProt Protein Name
Carbonic anhydrase 1
UniProt Gene Name
CA1
UniProt Synonym Gene Names
CAB; CA-I
UniProt Entry Name
CAH1_HUMAN
Similar Products
Product Notes
The CA1 ca1 (Catalog #AAA235617) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-261aa; Full Length of Mature Protein. The amino acid sequence is listed below: ASPDWGYDDK NGPEQWSKLY PIANGNNQSP VDIKTSETKH DTSLKPISVS YNPATAKEII NVGHSFHVNF EDNDNRSVLK GGPFSDSYRL FQFHFHWGST NEHGSEHTVD GVKYSAELHV AHWNSAKYSS LAEAASKADG LAVIGVLMKV GEANPKLQKV LDALQAIKTK GKRAPFTNFD PSTLLPSSLD FWTYPGSLTH PPLYESVTWI ICKESISVSS EQLAQFRSLL SNVEGDNAVP MQHNNRPTQP LKGRTVRASF. It is sometimes possible for the material contained within the vial of "Carbonic Anhydrase 1 (CA1), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.