SDS-PAGE
Interleukin-21 protein (Il21) Active Protein | Il21 active protein
Recombinant Mouse Interleukin-21 protein (Il21) (Active)
Gene Names
Il21; IL-21
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Interleukin-21 protein (Il21); N/A; Recombinant Mouse Interleukin-21 protein (Il21) (Active); IL-21; Il21 active protein
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized
Sequence Positions
18-146aa; Full Length of Mature Protein
Sequence
HKSSPQGPDRLLIRLRHLIDIVEQLKIYENDLDPELLSAPQDVKGHCEHAAFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARRGGKKQKHIAKCPSCDSYEKRTPKEFLERLKWLLQKMIHQHLS
Species
Mus musculus (Mouse)
Biological Activity
Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human N1186 T cells is less than 25 ng/ml, corresponding to a specific activity of > 4.0 × 104 IU/mg.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Protein Note
Protein will be provided with aseptic processing and endotoxin removal.
Preparation and Storage
Generally, the shelf life of liquid form is 6 months at -20/-80 degree C. The shelf life of lyophilized form is 12 months at -20/-80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for Il21 active protein
Cytokine with immunoregulatory activity. May promote the transition between innate and adaptive immunity. Induces the production of IgG(1) and IgG(3) in B-cells. May play a role in proliferation and maturation of natural killer (NK) cells in synergy with IL15. May regulate proliferation of mature B- and T-cells in response to activating stimuli. In synergy with IL15 and IL18 stimulates interferon gamma production in T-cells and NK cells (By similarity). During T-cell mediated immune response may inhibit dendritic cells (DC) activation and maturation. {ECO:0000250, ECO:0000269|PubMed:11970879, ECO:0000269|PubMed:12893770, ECO:0000269|PubMed:15100251}.
Product Categories/Family for Il21 active protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15.0 kDa
NCBI Official Full Name
interleukin-21 isoform 2
NCBI Official Synonym Full Names
interleukin 21
NCBI Official Symbol
Il21
NCBI Official Synonym Symbols
IL-21
NCBI Protein Information
interleukin-21
UniProt Protein Name
Interleukin-21
UniProt Gene Name
Il21
UniProt Synonym Gene Names
IL-21
Similar Products
Product Notes
The Il21 il21 (Catalog #AAA114250) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 18-146aa; Full Length of Mature Protein. The amino acid sequence is listed below: HKSSPQGPDR LLIRLRHLID IVEQLKIYEN DLDPELLSAP QDVKGHCEHA AFACFQKAKL KPSNPGNNKT FIIDLVAQLR RRLPARRGGK KQKHIAKCPS CDSYEKRTPK EFLERLKWLL QKMIHQHLS. It is sometimes possible for the material contained within the vial of "Interleukin-21 protein (Il21), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.