Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Interleukin-7 (IL7) Active Protein | IL7 active protein

Recombinant Human Interleukin-7 (IL7)

Average rating 0.0
No ratings yet
Gene Names
IL7; IL-7
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Interleukin-7 (IL7); N/A; Recombinant Human Interleukin-7 (IL7); Interleukin-7; IL-7; IL7; IL7 active protein
Ordering
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 mum Filtered 20 mM PB, 250 mM NaCl, pH 7.2
Sequence Positions
26-177aa; Full Length of Mature Protein
Sequence
DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH
Sequence Length
115
Species
Human
Tag
Tag-Free
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined in a cell proliferation assay using PHA-activated human peripheral blood lymphocytes (PBL) is less than 0.4 ng/ml.
Subcellular Location
Secreted
Protein Families
IL-7/IL-9 Family
Classification
Cytokine
Subdivision
Interleukin
Pathway
Jak-STAT Signaling Pathway
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for IL7 active protein
Relevance: Human Interleukin 7 (IL-7) is a potent lymphoid cell growth factor stimulating the proliferation of lymphoid progenitors. IL7 can associate with the hepatocyte growth factor (HGF) to form a hybrid cytokine that functions as a pre-pro-B cell growth-stimulating factor. Human IL7 cDNA encodes a 177 amino acid precursor protein containing a 25 amino acid signal peptide and a 152 amino acid mature protein. Human and mouse IL7 share 65% sequence identity in the mature region and both exhibit cross-species activity. IL-7 signals via IL-7 receptor (IL7R) activating multiple pathways including JaK/STAT and PI3K/AKT, which regulate lymphocyte survival, glucose uptake, proliferation, and differentiation. IL-7 is also associated with cytoplasmic IL2-R gamma for signal transduction.

Function: Hematopoietic growth factor capable of stimulating the proliferation of lymphoid progenitors. It is important for proliferation during certain stages of B-cell maturation.
Product Categories/Family for IL7 active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17.5 kDa
NCBI Official Full Name
interleukin-7 isoform 4
NCBI Official Synonym Full Names
interleukin 7
NCBI Official Symbol
IL7
NCBI Official Synonym Symbols
IL-7
NCBI Protein Information
interleukin-7
UniProt Protein Name
Interleukin-7
UniProt Gene Name
IL7
UniProt Synonym Gene Names
IL-7
UniProt Entry Name
IL7_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The IL7 il7 (Catalog #AAA235615) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 26-177aa; Full Length of Mature Protein. The amino acid sequence is listed below: DCDIEGKDGK QYESVLMVSI DQLLDSMKEI GSNCLNNEFN FFKRHICDAN KEGMFLFRAA RKLRQFLKMN STGDFDLHLL KVSEGTTILL NCTGQVKGRK PAALGEAQPT KSLEENKSLK EQKKLNDLCF LKRLLQEIKT CWNKILMGTK EH. It is sometimes possible for the material contained within the vial of "Interleukin-7 (IL7), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.