Bioactivity
(Measured by its binding ability in a functional ELISA. Immobilized Human MYL12A at 2?g/mL can bind Anti-MYL9 recombinant antibody, the EC50 is 5.325-6.456 ng/mL.)
Myosin regulatory light chain 12A (MYL12A) Active Protein | MYL12A active protein
Recombinant Human Myosin regulatory light chain 12A (MYL12A)(Active)
Gene Names
MYL12A; MLCB; MRCL3; MRLC3; MYL2B; MLC-2B; HEL-S-24
Purity
Greater than 95% as determined by SDS-PAGE.
Synonyms
Myosin regulatory light chain 12A (MYL12A); N/A; Recombinant Human Myosin regulatory light chain 12A (MYL12A)(Active); MLCB; MRLC3; RLC; MYL12A active protein
Host
E Coli
Purity/Purification
Greater than 95% as determined by SDS-PAGE.
Form/Format
Lyophilized powder
Lyophilized from a 0.2 um filtered PBS, 6% Trehalose, pH 7.4
Lyophilized from a 0.2 um filtered PBS, 6% Trehalose, pH 7.4
Sequence Positions
1-171aa; Full Length
Sequence
MSSKRTKTKTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD$
Species
Homo sapiens (Human)
Tag
C-terminal 6xHis-tagged
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Research Area
Cancer
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized Human MYL12A at 2 ug/mL can bind Anti-MYL9 recombinant antibody. The EC50 is 5.325-6.456 ng/mL.
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Bioactivity
(Measured by its binding ability in a functional ELISA. Immobilized Human MYL12A at 2?g/mL can bind Anti-MYL9 recombinant antibody, the EC50 is 5.325-6.456 ng/mL.)
Bioactivity
(Measured by its binding ability in a functional ELISA. Immobilized Human MYL12A at 2?g/mL can bind Anti-MYL9 recombinant antibody, the EC50 is 5.325-6.456 ng/mL.)
SDS-PAGE
((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)
SDS-PAGE
((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)
Related Product Information for MYL12A active protein
Myosin regulatory subunit that plays an important role in regulation of both smooth muscle and nonmuscle cell contractile activity via its phosphorylation. Implicated in cytokinesis, receptor capping, and cell locomotion.
Product Categories/Family for MYL12A active protein
References
"Diphosphorylated MRLC is required for organization of stress fibers in interphase cells and the contractile ring in dividing cells."Iwasaki T., Murata-Hori M., Ishitobi S., Hosoya H.Cell Struct. Funct. 26:677-683 (2001)"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."The MGC Project Team.Genome Res. 14:2121-2127 (2004)"Isoforms of myosin and actin in human, monkey and rat myometrium. Comparison of pregnant and non-pregnant uterus proteins."Cavaille F., Janmot C., Ropert S., d'Albis A.Eur J Biochem 160:507-513 (1986)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
171
NCBI Official Full Name
Myosin regulatory light chain 12A
NCBI Official Synonym Full Names
myosin, light chain 12A, regulatory, non-sarcomeric
NCBI Official Symbol
MYL12A
NCBI Official Synonym Symbols
MLCB; MRCL3; MRLC3; MYL2B; MLC-2B; HEL-S-24
NCBI Protein Information
myosin regulatory light chain 12A; myosin RLC; myosin regulatory light chain 3; epididymis secretory protein Li 24; myosin regulatory light chain MRLC3; myosin regulatory light chain 2, nonsarcomeric; myosin, light polypeptide, regulatory, non-sarcomeric
UniProt Protein Name
Myosin regulatory light chain 12A
UniProt Gene Name
MYL12A
UniProt Synonym Gene Names
MLCB; MRLC3; RLC; HEL-S-24
UniProt Entry Name
ML12A_HUMAN
Similar Products
Product Notes
The MYL12A myl12a (Catalog #AAA279221) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-171aa; Full Length. The amino acid sequence is listed below: MSSKRTKTKT KKRPQRATSN VFAMFDQSQI QEFKEAFNMI DQNRDGFIDK EDLHDMLASL GKNPTDEYLD AMMNEAPGPI NFTMFLTMFG EKLNGTDPED VIRNAFACFD EEATGTIQED YLRELLTTMG DRFTDEEVDE LYREAPIDKK GNFNYIEFTR ILKHGAKDKD D$. It is sometimes possible for the material contained within the vial of "Myosin regulatory light chain 12A (MYL12A), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.