VEGF145 active protein

Human VEGF145

Cat. Num. AAA14947

• Gene Names: VEGFA; VPF; VEGF; MVCD1
• Purity: > 95% by SDS-PAGE & silver stain
• Synonyms: VEGF145; N/A; Human VEGF145; VEGF-A, VPF; VEGF145 active protein

• Host: E.coli
• Purity/Purification: > 95% by SDS-PAGE & silver stain
• Form/Format: Lyophilized; 50 mM acetic acid
• Sequence: APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRRKKSRYKSWSVCDKPRR

• Endotoxin level: < 0.1ng per ug of human VEGF₁₄₅
• Stabilizer: None
• Length (aa): 145
• Result by N-terminal sequencing: APMAEGG
• Reconstitution: The lyophilized VEGF₁₄₅ should be reconstituted in water to a concentration not lower than 50 ug/ml. For long term storage we recommend to add at least 0.1% human or bovine serum albumin.
• Biological Activity: The ED₅₀ for stimulation of cell proliferation in human umbilical vein endothelial cells by VEGF₁₄₅ has been determined to be in the range of 5-10 ng/ml.
• Preparation and Storage: Lyophilized samples are stable for greater than six months at -20°C to -70°C. Reconstituted VEGF₁₄₅ should be stored in working aliquots at -20°C. Avoid repeated freeze and thaw cycles.

Application Data

SDS-PAGE

Related Product Information for VEGF145 active protein

A vascular endothelial growth factor (VEGF) mRNA species containing exons 1–6 and 8 of the VEGF gene was found to be expressed as a major VEGF mRNA form in several cell lines derived from carcinomas of the female reproductive system. This mRNA is predicted to encode a VEGF form of 145 amino acids (VEGF145). VEGF145 produced in insect cells is a homodimeric, 20,5 kDa protein belonging to the VEGF-A family.
Recombinant VEGF145 induced the proliferation of vascular endothelial cells and promoted angiogenesis in vivo. VEGF145 was compared with previously characterized VEGF species with respect to interaction with Heparin-like molecules, cellular distribution, VEGF receptor recognition, and extracellular matrix (ECM) binding ability. VEGF145 shares with VEGF165 the ability to bind to the KDR/flk-1 receptor of endothelial cells. It also binds to heparin with an affinity similar to that of VEGF165. However, VEGF145 does not bind to two additional endothelial cell surface receptors that are recognized by VEGF165 but not by VEGF121. VEGF145 is secreted from producing cells as are VEGF121 and VEGF165. However, VEGF121 and VEGF165 do not bind to the ECM produced by corneal endothelial cells, whereas VEGF145 binds efficiently to this ECM. Basic fibroblast growth factor (bFGF)-depleted ECM containing bound VEGF145 induces proliferation of endothelial cells, indicating that the bound VEGF145 is active. It seems that VEGF145 possesses a unique combination of biological properties distinct from those of previously characterized VEGF species. The other members of this increasing growth factor family are VEGF-B, -C, -D, -E and -F. Another member is the Placenta growth factor PlGF (PlGF-1, -2 and -3).

Product Categories/Family for VEGF145 active protein

Cytokines & Growth Factors

References

1. Breier et al., Dev 114:521, 1992 2. Fiebig et al., Eur J Biochem 211:19, 1993 3. Flamme et al., Dev Biol 162:699, 1995 4. Kremer at al., Cancer Res 57:3852, 1997 5. Poltorak et al., JBC 272:7151, 1997

NCBI and Uniprot Product Information

• NCBI GI #: 76781480
• NCBI GeneID: 7422
• NCBI Accession #: NP_001191313.1
• NCBI GenBank Nucleotide #: NM_001171624
• UniProt Accession #: P15692-6; O60720; O75875; Q074Z4; Q16889; Q5UB46; Q6P0P5; Q96KJ0; Q96L82; Q96NW5; Q9H1W8; B5BU86; P15692
• Molecular Weight: 34 kDa
• NCBI Official Full Name: vascular endothelial growth factor A isoform a
• NCBI Official Synonym Full Names: vascular endothelial growth factor A
• NCBI Official Symbol: VEGFA
• NCBI Official Synonym Symbols: VPF; VEGF; MVCD1
• NCBI Protein Information: vascular endothelial growth factor A; vascular permeability factor
• UniProt Protein Name: Vascular endothelial growth factor A
• UniProt Gene Name: VEGFA
• UniProt Synonym Gene Names: VEGF; VEGF-A; VPF
• UniProt Entry Name: VEGFA_HUMAN