Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA14947_APP2.jpg Application Data

VEGF145 active protein

Human VEGF145

Average rating 0.0
No ratings yet
Gene Names
VEGFA; VPF; VEGF; MVCD1
Purity
> 95% by SDS-PAGE & silver stain
Synonyms
VEGF145; N/A; Human VEGF145; VEGF-A, VPF; VEGF145 active protein
Ordering
Host
E.coli
Purity/Purification
> 95% by SDS-PAGE & silver stain
Form/Format
Lyophilized; 50 mM acetic acid
Sequence
APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRRKKSRYKSWSVCDKPRR
Endotoxin level
< 0.1ng per ug of human VEGF145
Stabilizer
None
Length (aa)
145
Result by N-terminal sequencing
APMAEGG
Reconstitution
The lyophilized VEGF145 should be reconstituted in water to a concentration not lower than 50 ug/ml. For long term storage we recommend to add at least 0.1% human or bovine serum albumin.
Biological Activity
The ED50 for stimulation of cell proliferation in human umbilical vein endothelial cells by VEGF145 has been determined to be in the range of 5-10 ng/ml.
Preparation and Storage
Lyophilized samples are stable for greater than six months at -20°C to -70°C. Reconstituted VEGF145 should be stored in working aliquots at -20°C. Avoid repeated freeze and thaw cycles.

Application Data

product-image-AAA14947_APP2.jpg Application Data

SDS-PAGE

product-image-AAA14947_SDS_PAGE.jpg SDS-PAGE
Related Product Information for VEGF145 active protein
A vascular endothelial growth factor (VEGF) mRNA species containing exons 1–6 and 8 of the VEGF gene was found to be expressed as a major VEGF mRNA form in several cell lines derived from carcinomas of the female reproductive system. This mRNA is predicted to encode a VEGF form of 145 amino acids (VEGF145). VEGF145 produced in insect cells is a homodimeric, 20,5 kDa protein belonging to the VEGF-A family.
Recombinant VEGF145 induced the proliferation of vascular endothelial cells and promoted angiogenesis in vivo. VEGF145 was compared with previously characterized VEGF species with respect to interaction with Heparin-like molecules, cellular distribution, VEGF receptor recognition, and extracellular matrix (ECM) binding ability. VEGF145 shares with VEGF165 the ability to bind to the KDR/flk-1 receptor of endothelial cells. It also binds to heparin with an affinity similar to that of VEGF165. However, VEGF145 does not bind to two additional endothelial cell surface receptors that are recognized by VEGF165 but not by VEGF121. VEGF145 is secreted from producing cells as are VEGF121 and VEGF165. However, VEGF121 and VEGF165 do not bind to the ECM produced by corneal endothelial cells, whereas VEGF145 binds efficiently to this ECM. Basic fibroblast growth factor (bFGF)-depleted ECM containing bound VEGF145 induces proliferation of endothelial cells, indicating that the bound VEGF145 is active. It seems that VEGF145 possesses a unique combination of biological properties distinct from those of previously characterized VEGF species. The other members of this increasing growth factor family are VEGF-B, -C, -D, -E and -F. Another member is the Placenta growth factor PlGF (PlGF-1, -2 and -3).
Product Categories/Family for VEGF145 active protein
References
1. Breier et al., Dev 114:521, 1992 2. Fiebig et al., Eur J Biochem 211:19, 1993 3. Flamme et al., Dev Biol 162:699, 1995 4. Kremer at al., Cancer Res 57:3852, 1997 5. Poltorak et al., JBC 272:7151, 1997

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
34 kDa
NCBI Official Full Name
vascular endothelial growth factor A isoform a
NCBI Official Synonym Full Names
vascular endothelial growth factor A
NCBI Official Symbol
VEGFA
NCBI Official Synonym Symbols
VPF; VEGF; MVCD1
NCBI Protein Information
vascular endothelial growth factor A; vascular permeability factor
UniProt Protein Name
Vascular endothelial growth factor A
UniProt Gene Name
VEGFA
UniProt Synonym Gene Names
VEGF; VEGF-A; VPF
UniProt Entry Name
VEGFA_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The VEGF145 vegfa (Catalog #AAA14947) is an Active Protein produced from E.coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: APMAEGGGQN HHEVVKFMDV YQRSYCHPIE TLVDIFQEYP DEIEYIFKPS CVPLMRCGGC CNDEGLECVP TEESNITMQI MRIKPHQGQH IGEMSFLQHN KCECRPKKDR ARQEKKSVRG KGKGQKRRKK SRYKSWSVCD KPRR. It is sometimes possible for the material contained within the vial of "VEGF145, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.