Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA14955_APP2.jpg Application Data (VEGF206-induced proliferation of primary human dermal lymphatic endothelial cells (HDLEC). HDLECs were stimulated with increasing amounts of human VEGF206.)

VEGF206 active protein

Recombinant Human Vascular Endothelial Growth Factor206

Average rating 0.0
No ratings yet
Gene Names
VEGFA; VPF; VEGF; MVCD1
Purity
> 75% by SDS-PAGE & Coomassie stain
Synonyms
VEGF206; N/A; Recombinant Human Vascular Endothelial Growth Factor206; VEGF-A, VPF; VEGF206 active protein
Ordering
Host
E.coli
Purity/Purification
> 75% by SDS-PAGE & Coomassie stain
Form/Format
Lyophilized; 50 mM acetic acid
Sequence
APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRRKKSRYKSWSVYVGARCCLMPWSLPGPHPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Gene
vegf
Length (aa)
206
Result by N-terminal sequencing
APMAEGG
Reconstitution
Centrifuge the vial prior to opening! The lyophilized VEGF206 should be reconstituted in 50mM acetic acid to a concentration not lower than 50 ug/ml. For long term storage we recommend to add at least 0.1% human or bovine serum albumin.
Biological Activity
The ED50 for stimulation of cell proliferation in human dermal lymphatic endothelial cells (HDLEC) by VEGF206 has been determined to be in the range of 5-15 ng/ml.
Preparation and Storage
The lyophilized protein is stable for a few weeks at room temperature, but best stored at -20°C. Reconstituted VEGF206 should be stored in working aliquots at -20°C. Avoid repeated freeze-thaw cycles.

Application Data

(VEGF206-induced proliferation of primary human dermal lymphatic endothelial cells (HDLEC). HDLECs were stimulated with increasing amounts of human VEGF206.)

product-image-AAA14955_APP2.jpg Application Data (VEGF206-induced proliferation of primary human dermal lymphatic endothelial cells (HDLEC). HDLECs were stimulated with increasing amounts of human VEGF206.)

SDS-PAGE

(SDS-PAGE analysis of recombinant human VEGF206 produced in E. coli. Sample was loaded under reducing conditions in 15% SDS polyacrylamide gel and stained with Coomassie blue.)

product-image-AAA14955_SDS_PAGE.jpg SDS-PAGE (SDS-PAGE analysis of recombinant human VEGF206 produced in E. coli. Sample was loaded under reducing conditions in 15% SDS polyacrylamide gel and stained with Coomassie blue.)
Related Product Information for VEGF206 active protein
Vascular endothelial growth factor-A (VEGF-A) mRNA undergoes alternative splicing events that generate several different homodimeric isoforms, e.g. VEGF121, VEGF145, VEGF165, VEGF189, and VEGF206. VEGF121 is a non-heparin-binding acidic protein, which is freely diffusible. The longer forms, VEGF189 or VEGF206, are highly basic proteins tightly bound to extracellular heparin-containing proteoglycans. VEGF165 has intermediate properties. VEGF165 was observed largely in Golgi apparatus-like structures. Immunogold labeling of cells expressing VEGF189 or VEGF206 revealed that the staining was localized to the subepithelial ECM. VEGF associated with the ECM was bioactive, because endothelial cells cultured on ECM derived from cells expressing VEGF189 or VEGF206 were markedly stimulated to proliferate. In addition, ECM-bound VEGF can be released into a soluble and bioactive form by heparin or plasmin. ECM-bound VEGF189 and VEGF206 have molecular masses consistent with the intact polypeptides. The ECM may represent an important source of VEGF and angiogenic potential. The isoforms VEGF145, VEGF165 and VEGF189 bind to heparin with high affinity, the affinity of VEGF206 is much weaker. All dimeric forms have similar biological activities but their bio-availability is very different. However so far there are only a few data about the biological activities of VEGF206.
Product Categories/Family for VEGF206 active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
~47 kDa (Dimer)
NCBI Official Full Name
vascular endothelial growth factor A isoform a
NCBI Official Synonym Full Names
vascular endothelial growth factor A
NCBI Official Symbol
VEGFA
NCBI Official Synonym Symbols
VPF; VEGF; MVCD1
NCBI Protein Information
vascular endothelial growth factor A; vascular permeability factor
UniProt Protein Name
Vascular endothelial growth factor A
UniProt Gene Name
VEGFA
UniProt Synonym Gene Names
VEGF; VEGF-A; VPF
UniProt Entry Name
VEGFA_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The VEGF206 vegfa (Catalog #AAA14955) is an Active Protein produced from E.coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: APMAEGGGQN HHEVVKFMDV YQRSYCHPIE TLVDIFQEYP DEIEYIFKPS CVPLMRCGGC CNDEGLECVP TEESNITMQI MRIKPHQGQH IGEMSFLQHN KCECRPKKDR ARQEKKSVRG KGKGQKRRKK SRYKSWSVYV GARCCLMPWS LPGPHPCGPC SERRKHLFVQ DPQTCKCSCK NTDSRCKARQ LELNERTCRC DKPRR. It is sometimes possible for the material contained within the vial of "VEGF206, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.