Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Ebola Virus Antigen

Ebola Virus Antigen >95%

Average rating 0.0
No ratings yet
Applications
Lateral Flow, ELISA
Purity
>95% by SDS-PAGE
Synonyms
Ebola Virus; N/A; Ebola Virus Antigen >95%; Ebola Virus antigen
Ordering
Host
E Coli
Specificity
Ebola Virus (Zaire) IgG and IgM
Purity/Purification
>95% by SDS-PAGE
Form/Format
Recombinant Antigen
10 mM Phosphate Buffered Saline, pH 7.2 with 25 mM Arginin
Concentration
1.23 mg/mL (varies by lot)
Sequence
RRVILPTAPPEYMEAIYPVRSNSTIARGGNSNTGFLTPESVNGDTPSNPLRPIADDTIDHASHTPGSVSSAFILEAMVNVISGPKVLMKQIPIWLPLGVADQKTYSFDSTTAAIMLASYTITHFGKATNPLVRVNRLGPGIPDHPLRLLRIGNQAFLQEFVLPPVQLPQYFTFDLTALKLITQPLPAATWTDDTPTGSNGALRPGISFHPKLRPILLPNKSGKKGNSADLTSPEKIQAIMTSLQDFKIVPIDPTKNIMGIEVPETLVHKLTGKKVTSKNGQPIIPVLLPKYIGLDPVAPGDLTMVITQDCGTCHSPASLPAVIEK
Sequence Length
676
Applicable Applications for Ebola Virus antigen
LF (Lateral Flow), ELISA
Preservative
0.02% Sodium Azide
Preparation and Storage
-20 degree C. Avoid repeated freezing and thawing.
Product Categories/Family for Ebola Virus antigen

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The Ebola Virus (Catalog #AAA77340) is an Antigen produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Ebola Virus can be used in a range of immunoassay formats including, but not limited to, LF (Lateral Flow), ELISA. Researchers should empirically determine the suitability of the Ebola Virus for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: RRVILPTAPP EYMEAIYPVR SNSTIARGGN SNTGFLTPES VNGDTPSNPL RPIADDTIDH ASHTPGSVSS AFILEAMVNV ISGPKVLMKQ IPIWLPLGVA DQKTYSFDST TAAIMLASYT ITHFGKATNP LVRVNRLGPG IPDHPLRLLR IGNQAFLQEF VLPPVQLPQY FTFDLTALKL ITQPLPAATW TDDTPTGSNG ALRPGISFHP KLRPILLPNK SGKKGNSADL TSPEKIQAIM TSLQDFKIVP IDPTKNIMGI EVPETLVHKL TGKKVTSKNG QPIIPVLLPK YIGLDPVAPG DLTMVITQDC GTCHSPASLP AVIEK. It is sometimes possible for the material contained within the vial of "Ebola Virus, Antigen" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.