Host
E Coli
Purity/Purification
>90%
Form/Format
50mM NaH2PO4, 500mM NaCl Buffer with 500mM Imidazole,10%glycerol(PH8.0)
Concentration
1mg/mL (varies by lot)
Sequence Positions
501-680aa
Sequence
SQHTLQADSVDLASCDLTSSATDGDEEDILSHSSSQVSAVPSDPAMDLNDGTQASSPISDSSQTTTEGPDSAVTPSDSSEIVLDGTDNQYLGLQIGQPQDEDEEATGILPDEASEAFRNSSMALQQALLKNMSHCRQPSDSSVDKFVLRDEATEPGDQENKPCRIKGDIGQSTDDDSAP
Sequence Length
3144
Applicable Applications for HTT protein
WB (Western Blot), ELISA
Organism
Homo sapiens(human)
Preparation and Storage
Store at -20 degree C.
Avoid repeated freezing and thawing.
Avoid repeated freezing and thawing.
Related Product Information for HTT protein
recombinant protein with His-tag
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
huntingtin
NCBI Official Synonym Full Names
huntingtin
NCBI Official Symbol
HTT
NCBI Official Synonym Symbols
HD; IT15; LOMARS
NCBI Protein Information
huntingtin
UniProt Protein Name
Huntingtin
UniProt Gene Name
HTT
UniProt Synonym Gene Names
HD; IT15; HD protein
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The HTT htt (Catalog #AAA196548) is a Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 501-680aa. AAA Biotech's Huntingtin can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), ELISA. Researchers should empirically determine the suitability of the HTT htt for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SQHTLQADSV DLASCDLTSS ATDGDEEDIL SHSSSQVSAV PSDPAMDLND GTQASSPISD SSQTTTEGPD SAVTPSDSSE IVLDGTDNQY LGLQIGQPQD EDEEATGILP DEASEAFRNS SMALQQALLK NMSHCRQPSD SSVDKFVLRD EATEPGDQEN KPCRIKGDIG QSTDDDSAP. It is sometimes possible for the material contained within the vial of "Huntingtin, Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
