Galectin-1 Active Protein | LGALS1 active protein
Human Galectin-1
Gene Names
LGALS1; GBP; GAL1
Reactivity
Human
Purity
> 98% by SDS-PAGE and HPLC analyses
Synonyms
Galectin-1; N/A; Human Galectin-1; Recombinant Human Galectin-1; LGALS1 active protein
Host
E Coli
Reactivity
Human
Purity/Purification
> 98% by SDS-PAGE and HPLC analyses
Form/Format
Lyophilized
Sequence
ACGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFN AHGDANTIVCNSKDGGAWGTEQREAVFPFQPGSVAEVCITFDQANLTVKL PDGYEFKFPNRLNLEAINYMAADGDFKIKCVAFD
Sequence Length
134
Endotoxin Level
< 0.1 ng/ug of protein (<1EU/ug).
Biological Activity
Determined by its ability to chemoattract human blood monocytes. Chemotactic activity was observed at a concentration of 2.5 ug/ml with a peak response obtained at 250 ug/ml.
Reconstitution
Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1-1.0mg/m. Do not vortex. This solution can be stored at 2-8 degree C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at-20 to -80 degree C.
Preparation and Storage
Thy lyophilized protein is stable at room temperature for 1 month and at 4 degree C for 6 months. Reconstituted working aliquots are stable for 1 week at 2-8 degree C and for 3 months at -20 degree to -80 degree C.
Related Product Information for LGALS1 active protein
Lectins, of either plant or animal origin, are carbohydrate binding proteins that interact with glycoprotein and glycolipids on the surface of animal cells. The Galectins are lectins that recognize and interact with beta-galactoside moieties. Galectin-1 is an animal lectin that has been shown to interact with CD3, CD4, and CD45. It induces apoptosis of activated T-cells and T-leukemia cell lines and inhibits the protein phosphatase activity of CD45. Recombinant human Galectin-1 is a 14.5 kDa protein containing 134 amino acid residues.
Product Categories/Family for LGALS1 active protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
14.5 kDa
NCBI Official Full Name
galectin-1
NCBI Official Synonym Full Names
lectin, galactoside-binding, soluble, 1
NCBI Official Symbol
LGALS1
NCBI Official Synonym Symbols
GBP; GAL1
NCBI Protein Information
galectin-1; HBL; HPL; gal-1; HLBP14; galaptin; galectin 1; 14 kDa lectin; S-Lac lectin 1; lactose-binding lectin 1; 14 kDa laminin-binding protein; putative MAPK-activating protein PM12; beta-galactoside-binding lectin L-14-I; beta-galactoside-binding protein 14kDa
UniProt Protein Name
Galectin-1
UniProt Gene Name
LGALS1
UniProt Synonym Gene Names
Gal-1; HLBP14
UniProt Entry Name
LEG1_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The LGALS1 lgals1 (Catalog #AAA79251) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The Human Galectin-1 reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: ACGLVASNLN LKPGECLRVR GEVAPDAKSF VLNLGKDSNN LCLHFNPRFN AHGDANTIVC NSKDGGAWGT EQREAVFPFQ PGSVAEVCIT FDQANLTVKL PDGYEFKFPN RLNLEAINYM AADGDFKIKC VAFD. It is sometimes possible for the material contained within the vial of "Galectin-1, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.