PDGF-AB active protein
Human PDGF-AB
Gene Names
PDGFA; PDGF1; PDGF-A
Reactivity
Human
Purity
> 95% by SDS-PAGE & silver stain
Synonyms
PDGF-AB; N/A; Human PDGF-AB; Recombinant Human Platelet-Derived Growth Factor-AB; Platelet-derived growth factor B chain; PDGF2; Proto-oncogene c-Sis; PDGF-AB active protein
Host
E Coli
Reactivity
Human
Purity/Purification
> 95% by SDS-PAGE & silver stain
Form/Format
Lyophilized
Sequence
Alpha chain: MSIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPP CVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLE EHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT Beta chain : MSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQ RCSGCCNNRNVQCRPTQVQLRPVQVRKIGIVRKKPIFKKATVTLGDHLAC KCETVAAARPVT
Sequence Length
126, 110
Endotoxin Level
< 0.1ng per ug of PDGF-AB
Buffer
50 mM acetic acid
Preparation and Storage
The lyophilized PDGF-AB is stable for a few weeks at room temperature, but best stored at -20 degree C. Reconstituted PDGF-AB is best stored at -20 degree C to -70 degree C. Avoid repeated freeze-thaw cycles.
Related Product Information for PDGF-AB active protein
DGFs are stored in platelet alpha-granules and are released upon platelet activation. The PDGFs are involved in a number of biological processes, including hyperplasia, chemotaxis, embryonic neuron development, and respiratory tubule epithelial cell development. Two distinct signaling receptors used by PDGFs have been identified and named PDGFR-alpha and PDGFR-beta. PDGFR-alpha is high-affinity receptor for each of the three PDGF forms. On the other hand, PDGFR-beta interacts with only PDGF-BB and PDGF-AB. Recombinant human PDGF-AB is a 25.5 kDa disulfide-linked dimer, consisting of one A chain and one B chains (234 total amino acids).
Product Categories/Family for PDGF-AB active protein
References
1. Fredriksson L et al, Cytokine Growth Factor Rev 15:197-204, 2004 2. Heldin CH et al, Br J Cancer 57:591-3, 1988 3. Deuel TFet al, Biofactors 1:213-7, 1988 4. Meyer-Ingold and Eichner W, Cell Biol Int 19:389-98, 1995 5. Betsholtz C and Raines EW, Kidney Int 51:1361-9, 1997 6. Kaetzel DM, Cytokine Growth Factor Rev 14:427-46, 2003 7. Simm A et al, Basic Res Cardiol Suppl 3:40-3, 1998
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
25,5 kDa
NCBI Official Full Name
platelet-derived growth factor subunit A isoform 1 preproprotein
NCBI Official Synonym Full Names
platelet-derived growth factor alpha polypeptide
NCBI Official Symbol
PDGFA
NCBI Official Synonym Symbols
PDGF1; PDGF-A
NCBI Protein Information
platelet-derived growth factor subunit A; PDGF-1; PDGF A-chain; PDGF subunit A; platelet-derived growth factor A chain; platelet-derived growth factor alpha chain; platelet-derived growth factor alpha isoform 2 preproprotein
UniProt Protein Name
Platelet-derived growth factor subunit A
UniProt Gene Name
PDGFA
UniProt Synonym Gene Names
PDGF1; PDGF subunit A
UniProt Entry Name
PDGFA_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The PDGF-AB pdgfa (Catalog #AAA79242) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The Human PDGF-AB reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Alpha chain: MSIEEAVPAV CKTRTVIYEI PRSQVDPTSA NFLIWPP CVEVKRCTGC CNTSSVKCQP SRVHHRSVKV AKVEYVRKKP KLKEVQVRLE EHLECACATT SLNPDYREED TGRPRESGKK RKRKRLKPT Beta chain : MSLGSLTIAE PAMIAECKTR TEVFEISRRL IDRTNANFLV WPPCVEVQ RCSGCCNNRN VQCRPTQVQL RPVQVRKIGI VRKKPIFKKA TVTLGDHLAC KCETVAAARP VT. It is sometimes possible for the material contained within the vial of "PDGF-AB, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
