Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281420_SDS_PAGE13.jpg SDS-PAGE (Recombinant Human IL-36 beta Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 18 kDa.)

IL-36 beta Active Protein | IL36B active protein

Recombinant Human IL-36 beta Protein

Average rating 0.0
No ratings yet
Gene Names
IL36B; FIL1; FIL1H; IL1F8; IL1H2; IL-1F8; IL-1H2; IL1-ETA; FIL1-(ETA); FILI-(ETA)
Purity
>92% by SDS-PAGE.
Synonyms
IL-36 beta; N/A; Recombinant Human IL-36 beta Protein; FIL1; FIL1-(ETA); FIL1H; FILI-(ETA); IL-1F8; IL-1H2; IL1-ETA; IL1F8; IL1H2; IL36B active protein
Ordering
Host
E Coli
Purity/Purification
>92% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
REAAPKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKDLCLFCAEIQGKPTLQLKEKNIMDLYVEKKAQKPFLFFHNKEGSTSVFQSVSYPGWFIATSTTSGQPIFLTKERGITNNTNFYLDSVE
Sequence Length
164
Species
Human
Endotoxin
< 0.1 EU/ug of the protein by LAL method.
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized recombinant human IL-36 beta at 1 ug/mL (100 uL/well) can bind recombinant human IL-1 Rrp2 Fc Chimera with a linear range of 0.15-5 ug/ml.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-PAGE

(Recombinant Human IL-36 beta Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 18 kDa.)

product-image-AAA281420_SDS_PAGE13.jpg SDS-PAGE (Recombinant Human IL-36 beta Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 18 kDa.)

Bioactivity

(Measured by its binding ability in a functional ELISA. Immobilized recombinant human IL-36 beta at 1 ug/mL (100 uL/well) can bind recombinant human IL-1 Rrp2 Fc Chimera with a linear range of 0.15-5 ug/ml.)

product-image-AAA281420_BIOACTIVITY15.jpg Bioactivity (Measured by its binding ability in a functional ELISA. Immobilized recombinant human IL-36 beta at 1 ug/mL (100 uL/well) can bind recombinant human IL-1 Rrp2 Fc Chimera with a linear range of 0.15-5 ug/ml.)
Related Product Information for IL36B active protein
Description: Recombinant Human IL-36 beta Protein is produced by E. coli expression system. The target protein is expressed with sequence (Arg5-Glu157) of human IL-36 beta (Accession #NP_775270.1) fused with a 6xHis tag at the C-terminus.

Background: Interleukin-1 family member 8(IL1F8) also known as IL36B, is a member of the interleukin 1(IL-1) cytokine family. IL-36 beta is expressed by keratinocytes, naïve CD4+ T cells, neurons, and glia. It is up-regulated in keratinocytes and synovial fibroblasts by inflammatory stimulation and in psoriatic lesions. IL-36 beta promotes inflammatory responses by enhancing the activation and Th1 polarization of dendritic cells and T cells. It also enhances the production of multiple pro-inflammatory cytokines, chemokines, and anti-bacterial defensin peptides by keratinocytes, synovial fibroblasts, and articular chondrocytes. IL-1 family members exert their effects through binding to receptors that belong to the IL-1 receptor (IL-1R) family.
Product Categories/Family for IL36B active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
interleukin-36 beta isoform 1
NCBI Official Synonym Full Names
interleukin 36 beta
NCBI Official Symbol
IL36B
NCBI Official Synonym Symbols
FIL1; FIL1H; IL1F8; IL1H2; IL-1F8; IL-1H2; IL1-ETA; FIL1-(ETA); FILI-(ETA)
NCBI Protein Information
interleukin-36 beta
UniProt Protein Name
Interleukin-36 beta
UniProt Gene Name
IL36B
UniProt Synonym Gene Names
IL1F8; IL1H2; IL-1 eta; IL-1F8; IL-1H2
UniProt Entry Name
IL36B_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The IL36B il36b (Catalog #AAA281420) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: REAAPKSYAI RDSRQMVWVL SGNSLIAAPL SRSIKPVTLH LIACRDTEFS DKEKGNMVYL GIKGKDLCLF CAEIQGKPTL QLKEKNIMDL YVEKKAQKPF LFFHNKEGST SVFQSVSYPG WFIATSTTSG QPIFLTKERG ITNNTNFYLD SVE. It is sometimes possible for the material contained within the vial of "IL-36 beta, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.