MHC class I chain-related gene A Active Protein | MICA active protein
Recombinant Human MHC class I chain-related gene A
Gene Names
MICA; MIC-A; PERB11.1
Purity
Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Synonyms
MHC class I chain-related gene A; N/A; Recombinant Human MHC class I chain-related gene A; MICA Human; MHC Class-I chain related gene A Human Recombinant; MHC class I polypeptide-related sequence A; MIC-A; MICA; PERB11.1; HLA-B; AS; HLAB; HLAC; SPDA1; HLA-B73; HLA-B-7301; MICA active protein
Host
E Coli
Purity/Purification
Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Form/Format
Lyophilized from a concentrated (1mg/ml) solution containing no additives.
Sterile Filtered White lyophilized (freeze-dried) powder.
Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence
EPHSLRYNLTVLSWDGSVQSGFLAEVHLDGQPFLRYDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETEEWTVPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLESGVVLRRTVPPMVNVTRSEASEGNITVTCRASSFYPRNIILTWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICRGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSH
Sequence Length
383
Solubility
It is recommended to reconstitute the lyophilized MICA in sterile 18M Omega -cm H2O not less than 100 ug/ml, which can then be further diluted to other aqueous solutions.
Biological Activity
Measured by its ability to bind MICA antibody in ELISA.
Preparation and Storage
Lyophilized MICA although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution MICA should be stored at 4 degree C between 2-7 days and for future use below -18 degree C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Related Product Information for MICA active protein
MICA Human Recombinant produced in E Coli is a single, non-glycosylated polypeptide chain containing 320 amino acids and having a molecular mass of 36kDa. The sequence contains the full length extracellular domain of the mature human MICA (amino acid residues Ala23 Gln308) The MICA is purified by proprietary chromatographic techniques.
Product Categories/Family for MICA active protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
MHC class I polypeptide-related sequence A isoform 1 (MICA*001)
NCBI Official Synonym Full Names
MHC class I polypeptide-related sequence A
NCBI Official Symbol
MICA
NCBI Official Synonym Symbols
MIC-A; PERB11.1
NCBI Protein Information
MHC class I polypeptide-related sequence A; HLA class I antigen; MHC class I chain-related protein A; MICA; stress inducible class I homolog
UniProt Protein Name
MHC class I polypeptide-related sequence A
UniProt Gene Name
MICA
UniProt Synonym Gene Names
MIC-A
UniProt Entry Name
MICA_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The MICA mica (Catalog #AAA38458) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: EPHSLRYNLT VLSWDGSVQS GFLAEVHLDG QPFLRYDRQK CRAKPQGQWA EDVLGNKTWD RETRDLTGNG KDLRMTLAHI KDQKEGLHSL QEIRVCEIHE DNSTRSSQHF YYDGELFLSQ NLETEEWTVP QSSRAQTLAM NVRNFLKEDA MKTKTHYHAM HADCLQELRR YLESGVVLRR TVPPMVNVTR SEASEGNITV TCRASSFYPR NIILTWRQDG VSLSHDTQQW GDVLPDGNGT YQTWVATRIC RGEEQRFTCY MEHSGNHSTH PVPSGKVLVL QSH. It is sometimes possible for the material contained within the vial of "MHC class I chain-related gene A, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.