Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA79206_AD13.jpg Application Data

FGF-4 active protein

Mouse FGF-4

Average rating 0.0
No ratings yet
Gene Names
Fgf4; KS3; hst; Fgfk; Hst1; kFGF; Fgf-4; hst-1; Hstf-1
Reactivity
Mouse
Purity
> 95% by SDS-PAGE & silver stain
Synonyms
FGF-4; N/A; Mouse FGF-4; Recombinant Mouse FGF-4; HBGF-4; Heparin-binding growth factor 4; Kfgf; FGF-4 active protein
Ordering
Host
E Coli
Reactivity
Mouse
Purity/Purification
> 95% by SDS-PAGE & silver stain
Form/Format
Lyophilized
Sequence
MGHHHHHHHHHHSSGHIEGRHMAPNGTRHAELGHGWDGLVARSLARLPVA AQPPQAAVRSGAGDYLLGLKRLRRLYCNVGIGFHLQVLPDGRIGGVHADT RDSLLELSPVQRGVVSIFGVASRFFVAMSSRGKLFGVPFFTDECKFKEIL LPNNYNAYEAYAYPGMFMALSKNGRTKKGNRVSPTMKVTHFLPRL
Sequence Length
195
Label/Conjugation
His-Tag
Biological Activity
The biological activity was determined by the induction of proliferation in NHDF cells (Normal Human Dermal Fibroblasts).
Reconstitution
We recommend a quick spin followed by reconstitution in water to a concentration of 0.1-1.0mg/ml. This solution can then be diluted into other aqueous buffers and stored at 4 degree C for 1 week or -20 degree C for future use.
Preparation and Storage
The lyophilized protein is stable for a few weeks at room temperature, but best stored at -20 degree C. Reconstituted FGF-4 should be stored in working aliquots at -20 degree C. Avoid repeated freeze-thaw cycles.

Application Data

product-image-AAA79206_AD13.jpg Application Data

Application Data

product-image-AAA79206_AD15.jpg Application Data
Related Product Information for FGF-4 active protein
FGF4 (fibroblast growth factor4), also known as FGF-K or K-FGF (Kaposi's sarcoma-associated FGF), is a 25 kDa secreted, heparin-binding member of the FGF family. The mouse FGF4 cDNA encodes 202 amino acids (aa) with a 29 aa signal sequence and a 173 aa mature protein with an FGF homology domain that contains a heparin binding region near the C-terminus. Mature mouse FGF 4 shares 87%, 90%, 87% and 85% aa identity with human, rat, canine and bovine FGF4, respectively. Human FGF4 has been shown to exhibit cross species activity. Expression of FGF4 and its receptors, FGF R1c, 2c, 3c and 4, is spatially and temporally regulated during embryonic development. Its expression in the trophoblast inner cell mass promotes expression of FGF R2, and is required for maintenance of the trophectoderm and primitive endoderm. Later in development, FGF4 works together with FGF8 to mediate the activities of the apical ectodermal ridge, which direct the outgrowth and patterning of vertebrate limbs. FGF4 is proposed to play a physiologically relevant role in human embryonic stem cell self-renewal. It promotes stem cell proliferation, but may also aid differentiation depending on context and concentration, and is often included in embryonic stem cell media in vitro. A C-terminally truncated 15 kDa isoform that opposes full length FGF4 and promotes differentiation is endogenously expressed in human embryonic stem cells. FGF4 is mitogenic for fibroblasts and endothelial cells in vitro and has autocrine transforming potential. It is a potent angiogenesis promoter in vivo and has been investigated as therapy for coronary artery disease.
Product Categories/Family for FGF-4 active protein
References
Hebert JM et al, Dev Biol 138:454, 1990 2. Niswander L and GR Martin, Development 114:755, 192 3. Feldman B et al, Science 267:246, 1995 4. Goldin SN and VE Papaioannou, Genesis 36:40, 2003 5. Sun, X. et al, Nature 418:501, 2002 6. Boulet AM et al, Dev Biol 273:361, 2004 7. Yu K and DM Ornitz, Development 135:483, 2008 8. Mariani FV et al, Nature 453:401, 2008 9. Kunath T et al, Development 134:2895, 2007 10. Mayshar Y et al, Stem Cells 26:767, 2008

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21,919 Da
NCBI Official Full Name
fibroblast growth factor 4
NCBI Official Synonym Full Names
fibroblast growth factor 4
NCBI Official Symbol
Fgf4
NCBI Official Synonym Symbols
KS3; hst; Fgfk; Hst1; kFGF; Fgf-4; hst-1; Hstf-1
NCBI Protein Information
fibroblast growth factor 4; HBGF-4; K-fibroblast growth factor; heparin-binding growth factor 4
UniProt Protein Name
Fibroblast growth factor 4
UniProt Gene Name
Fgf4
UniProt Synonym Gene Names
Fgf-4; Kfgf; FGF-4; HBGF-4
UniProt Entry Name
FGF4_MOUSE

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The FGF-4 fgf4 (Catalog #AAA79206) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The Mouse FGF-4 reacts with Mouse and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: MGHHHHHHHH HHSSGHIEGR HMAPNGTRHA ELGHGWDGLV ARSLARLPVA AQPPQAAVRS GAGDYLLGLK RLRRLYCNVG IGFHLQVLPD GRIGGVHADT RDSLLELSPV QRGVVSIFGV ASRFFVAMSS RGKLFGVPFF TDECKFKEIL LPNNYNAYEA YAYPGMFMAL SKNGRTKKGN RVSPTMKVTH FLPRL. It is sometimes possible for the material contained within the vial of "FGF-4, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.